KEGG   Candida glabrata: CAGL0D06138gHelp
Entry
CAGL0D06138g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cgr  Candida glabrata
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CAGL0D06138g
Enzymes [BR:cgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CAGL0D06138g
Exosome [BR:cgr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CAGL0D06138g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:578612..579634
Genome map
AA seq 340 aa AA seqDB search
MHTADFLDIEPTEISSILSGGYNHPLLREWQSERQLKKNMLIFPLFISDIPDEATPIDSL
PNIKRFGINKLVDYVKPLVEKGLRSVILFGVPLKEGTKDPVGTAADDPEGPVIQAIKLLR
KEFPELYIICDVCLCEYTSHGHCGVLYDDGTINRERSVSRIAAVAVNYAKAGAHCVAPSD
MIDGRIKDIKKGLISAGLAHKTFVLSYAAKFSGNLYGPFRDAACSSPSNGDRKCYQLPQA
GRGLARRALARDKNEGADGIIVKPSTFYLDIMRDASEICEDLPICAYHVSGEYAMLHAAA
EKGIVDLKSIAFESHEGFLRAGARLIISYFTPEFLDWLSN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcacactgcagactttctggacatcgagcctaccgagatttcatcaatcttgagtggt
ggctacaaccacccgctgctgagggaatggcaaagcgaacgtcagttgaagaagaatatg
ctcatattcccattgttcatctctgacattccagatgaggcaactccaattgattctcta
cctaatatcaagagattcggtatcaataaattggtggactatgtcaaaccgttagtcgaa
aagggcttgaggtctgttattcttttcggtgttcctttgaaagaaggcacaaaagaccca
gtaggtacagcagctgatgatccagaaggtccagttattcaagccatcaaacttttgcgt
aaagaatttccagagctttacataatctgtgatgtgtgtctttgcgaatacacttctcat
ggtcactgtggtgtgctctatgatgatggaaccatcaaccgtgagagaagtgtttcaaga
attgctgctgtagctgtcaactacgccaaggcaggtgcccactgtgttgcaccaagtgac
atgattgatggtagaatcaaggacatcaagaaaggcttgatatctgccggtctagcccac
aagacctttgtgctgtcttatgctgccaagttcagtggtaatttgtatggacctttcagg
gatgccgcctgttccagtccatcgaatggtgatcgtaaatgttaccaattaccacaggct
ggtcgtggccttgccagaagagcattggctagagataagaatgagggtgccgatggtatc
atcgtgaagccttctactttctatttggatattatgcgtgatgccagtgaaatctgcgag
gatttgcctatttgtgcctaccatgtttctggtgaatatgctatgttacatgctgcagcc
gaaaaaggtattgtcgacttgaagagcatagctttcgaatcgcatgaggggttcttgaga
gcaggcgcaagactgattatctcctatttcaccccagagtttttggattggttgagtaat
taa

DBGET integrated database retrieval system