KEGG   Candida glabrata: CAGL0D06600gHelp
Entry
CAGL0D06600g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
cgr  Candida glabrata
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:626571..628748
Genome map
AA seq 725 aa AA seqDB search
MLGFKRKRTNTNNNNNNTMNFAPDLLDDLMLDDRYLDENAILDDYDTAEAALDPVRYKKQ
RTVSLPQLPHSRLSYSYFVNTLDGSNSAAMTHATANLSSANMGTANQGLPHQALGSAYTH
HRYPADDNDMSSLLDASLYMGQNAHAALAQPALKSGNWVTPPARIQNDDELLHLTGSSSK
TLEGNRSVQLKVAHSVSPFTNENSTGAASGISAGFKNSFKRLLSHEQQPYDDNIPRRSSI
ASRRRSSVKRVQDAQGSLPNMNYFQTDKDGHYIYQENDVFGSNGQFVVKELLGQGTFGKV
LKCVDTYSPNNKFVAVKVIRAVDRYREAAKTELRVLSTILENDPVGQFQCLLLRDCFDYK
NHICLVTDLYGRSVYDFMCSNGVARFPGSHIQAIARQLIRSVCFLHDMGIIHTDLKPENI
LLVDESYVEYDLPQNVIDSMSNRRRAASQGKRKILTNPEIKIIDFGSAVFHKEYHPPVIS
TRHYRAPEIVLGLGWSFPCDVWSIACVLVELVIGESLYPIHENLEHMAMMQRINGTPFPT
KLIDKMFYKVRHKLGNLPSDLNTTVVRHFNRQSLTLQWPEKNKRGEIVTTEKSMKRVMES
CDRLDVYISRVLKQDYGERLSINWNLSPDKNWSLVSSKLLWRGHQHYDGNIYEGSHMFPP
QHKLDKDSFLFWYWFVDLCRKMFEFDPTKRITARKALDHEWFNLGIFDEGITNFANPRAN
YRNSI
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgctggggttcaagaggaaacggacgaacaccaacaacaacaacaacaacacgatgaat
ttcgctccagacttgctggatgatctgatgctggatgaccgctacttggacgagaacgct
atcctggatgactacgacaccgccgaggccgccctcgaccccgtgcggtacaagaagcag
cgcacggtgtccttgccgcagctgccacactcgcggctctcttactcgtacttcgtcaac
accctggacggctccaacagcgctgcgatgactcacgcgactgcgaacttgagctcagca
aacatgggcacagcaaaccagggactgccacaccaggcactgggaagcgcgtacacacac
cacagatacccggccgacgacaacgatatgtcctcgctcctggacgcatcgctgtacatg
ggccagaatgcgcacgcagcgctggcacagccggcgctcaagtccggaaactgggtcacc
ccgccagcacgcatacagaacgacgacgagctgctgcacttgaccggctcttcaagcaag
accctcgagggcaacagaagcgtgcagctgaaggtggcccacagcgtctcccctttcaca
aacgagaactcaacgggcgccgcctcaggaataagcgcaggtttcaaaaatagcttcaag
agacttctctcccatgaacaacaaccatacgacgataacataccaagacgcagcagtatc
gcgtccagaagacgcagcagtgtgaaaagggtgcaggacgcccaaggatcacttccgaat
atgaactacttccaaacagacaaagacggtcactacatataccaggaaaacgacgtgttt
ggctcaaacggccagttcgtcgttaaggaattgctggggcaaggcaccttcgggaaagtc
ttgaaatgcgtagatacttactccccaaataacaaatttgtggcagtgaaagtcataaga
gctgtagacagatacagagaggcagccaaaacagaattaagagtgctaagcactatatta
gaaaatgacccagtaggccaattccaatgcttactgcttagagattgttttgattataaa
aatcacatatgcctggtaacggacctgtacggaagatcggtatacgactttatgtgttct
aatggtgtggctagatttcctgggtcccacatacaggcaatagctagacagttgatcaga
tctgtatgtttcttgcatgatatgggcattatacatactgatttaaaaccggaaaatatc
ctgttggtggacgaatcttatgtggagtatgaccttccacaaaacgtgatagattctatg
agtaacagaaggcgagctgcctctcagggaaagagaaagatactgaccaatccggaaatt
aagattattgattttggaagtgcagtttttcataaggaatatcacccaccagttatatca
acaagacattatcgtgctccagaaattgttttaggtctggggtggtctttcccatgcgat
gtttggtcaatagcatgcgtattggtggagctagtaattggagaatctctatacccaatt
catgaaaatttggaacatatggcgatgatgcaaagaattaacggtactccttttcctaca
aaattgatcgataagatgttttacaaggtaagacacaaactaggaaatttgccatcagat
ctcaataccacggttgttagacacttcaatagacaatcactaactttgcagtggccagaa
aaaaataagcggggcgaaatagttactacagaaaaatcaatgaaaagagtaatggagtct
tgtgatagattggatgtctatatatcaagagtcctaaaacaagattatggtgaacgacta
agtataaactggaacctttcacccgataaaaattggagtttagtcagttcaaaactttta
tggaggggtcatcagcattatgatggcaacatctacgagggctctcatatgttccctcca
cagcataaattagataaggactctttcttgttctggtactggtttgtcgatctatgtcgt
aaaatgtttgaatttgatccaactaagagaattacagcgaggaaggcattggatcatgaa
tggttcaatttgggaatttttgatgaaggtattacaaactttgcaaatccaagagcaaac
tatagaaactccatttaa

DBGET integrated database retrieval system