KEGG   Candida glabrata: CAGL0D06600gHelp
Entry
CAGL0D06600g      CDS       T01024                                 

Definition
(RefSeq) hypothetical protein
  KO
K08287  dual-specificity kinase [EC:2.7.12.1]
Organism
cgr  Candida glabrata
Brite
Enzymes [BR:cgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     CAGL0D06600g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr RIO1 Kdo Kinase-like
Motif
Other DBs
NCBI-GeneID: 2887133
NCBI-ProteinID: XP_445692
UniProt: Q6FVQ2
Position
D:626571..628748
Genome map
AA seq 725 aa AA seqDB search
MLGFKRKRTNTNNNNNNTMNFAPDLLDDLMLDDRYLDENAILDDYDTAEAALDPVRYKKQ
RTVSLPQLPHSRLSYSYFVNTLDGSNSAAMTHATANLSSANMGTANQGLPHQALGSAYTH
HRYPADDNDMSSLLDASLYMGQNAHAALAQPALKSGNWVTPPARIQNDDELLHLTGSSSK
TLEGNRSVQLKVAHSVSPFTNENSTGAASGISAGFKNSFKRLLSHEQQPYDDNIPRRSSI
ASRRRSSVKRVQDAQGSLPNMNYFQTDKDGHYIYQENDVFGSNGQFVVKELLGQGTFGKV
LKCVDTYSPNNKFVAVKVIRAVDRYREAAKTELRVLSTILENDPVGQFQCLLLRDCFDYK
NHICLVTDLYGRSVYDFMCSNGVARFPGSHIQAIARQLIRSVCFLHDMGIIHTDLKPENI
LLVDESYVEYDLPQNVIDSMSNRRRAASQGKRKILTNPEIKIIDFGSAVFHKEYHPPVIS
TRHYRAPEIVLGLGWSFPCDVWSIACVLVELVIGESLYPIHENLEHMAMMQRINGTPFPT
KLIDKMFYKVRHKLGNLPSDLNTTVVRHFNRQSLTLQWPEKNKRGEIVTTEKSMKRVMES
CDRLDVYISRVLKQDYGERLSINWNLSPDKNWSLVSSKLLWRGHQHYDGNIYEGSHMFPP
QHKLDKDSFLFWYWFVDLCRKMFEFDPTKRITARKALDHEWFNLGIFDEGITNFANPRAN
YRNSI
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgctggggttcaagaggaaacggacgaacaccaacaacaacaacaacaacacgatgaat
ttcgctccagacttgctggatgatctgatgctggatgaccgctacttggacgagaacgct
atcctggatgactacgacaccgccgaggccgccctcgaccccgtgcggtacaagaagcag
cgcacggtgtccttgccgcagctgccacactcgcggctctcttactcgtacttcgtcaac
accctggacggctccaacagcgctgcgatgactcacgcgactgcgaacttgagctcagca
aacatgggcacagcaaaccagggactgccacaccaggcactgggaagcgcgtacacacac
cacagatacccggccgacgacaacgatatgtcctcgctcctggacgcatcgctgtacatg
ggccagaatgcgcacgcagcgctggcacagccggcgctcaagtccggaaactgggtcacc
ccgccagcacgcatacagaacgacgacgagctgctgcacttgaccggctcttcaagcaag
accctcgagggcaacagaagcgtgcagctgaaggtggcccacagcgtctcccctttcaca
aacgagaactcaacgggcgccgcctcaggaataagcgcaggtttcaaaaatagcttcaag
agacttctctcccatgaacaacaaccatacgacgataacataccaagacgcagcagtatc
gcgtccagaagacgcagcagtgtgaaaagggtgcaggacgcccaaggatcacttccgaat
atgaactacttccaaacagacaaagacggtcactacatataccaggaaaacgacgtgttt
ggctcaaacggccagttcgtcgttaaggaattgctggggcaaggcaccttcgggaaagtc
ttgaaatgcgtagatacttactccccaaataacaaatttgtggcagtgaaagtcataaga
gctgtagacagatacagagaggcagccaaaacagaattaagagtgctaagcactatatta
gaaaatgacccagtaggccaattccaatgcttactgcttagagattgttttgattataaa
aatcacatatgcctggtaacggacctgtacggaagatcggtatacgactttatgtgttct
aatggtgtggctagatttcctgggtcccacatacaggcaatagctagacagttgatcaga
tctgtatgtttcttgcatgatatgggcattatacatactgatttaaaaccggaaaatatc
ctgttggtggacgaatcttatgtggagtatgaccttccacaaaacgtgatagattctatg
agtaacagaaggcgagctgcctctcagggaaagagaaagatactgaccaatccggaaatt
aagattattgattttggaagtgcagtttttcataaggaatatcacccaccagttatatca
acaagacattatcgtgctccagaaattgttttaggtctggggtggtctttcccatgcgat
gtttggtcaatagcatgcgtattggtggagctagtaattggagaatctctatacccaatt
catgaaaatttggaacatatggcgatgatgcaaagaattaacggtactccttttcctaca
aaattgatcgataagatgttttacaaggtaagacacaaactaggaaatttgccatcagat
ctcaataccacggttgttagacacttcaatagacaatcactaactttgcagtggccagaa
aaaaataagcggggcgaaatagttactacagaaaaatcaatgaaaagagtaatggagtct
tgtgatagattggatgtctatatatcaagagtcctaaaacaagattatggtgaacgacta
agtataaactggaacctttcacccgataaaaattggagtttagtcagttcaaaactttta
tggaggggtcatcagcattatgatggcaacatctacgagggctctcatatgttccctcca
cagcataaattagataaggactctttcttgttctggtactggtttgtcgatctatgtcgt
aaaatgtttgaatttgatccaactaagagaattacagcgaggaaggcattggatcatgaa
tggttcaatttgggaatttttgatgaaggtattacaaactttgcaaatccaagagcaaac
tatagaaactccatttaa

DBGET integrated database retrieval system