KEGG   Candida glabrata: CAGL0E01287gHelp
Entry
CAGL0E01287g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cgr  Candida glabrata
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:cgr01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cgr00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:cgr00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:120804..122045
Genome map
AA seq 413 aa AA seqDB search
MLSRSAVCAKRYITPRHVAAWKLPVQKVVPAYLSQYRWASTSVKVPSMAESLTEGSLKEF
TKKVGEFVEQDELLATIETDKIDIEVNSPVSGTVTKLNFEPEDTVTVGDELAQIEEGGAP
ADGGAKPAAEESKPAEESKPAEQAKPAAPAAEKKSAPVKKPESPKQEASNAAQQAPSTAA
FSRNENRVKMNRMRMRIAERLKESQNTAASLTTFNEVDMSALMEMRKLYKDEIIKKTGTK
FGFMGLFSKACTLAAKDIPAVNGAIEGDQIVYRDYTDISIAVATPKGLVTPVVRNAESLS
VIEIEQEIVRLGQKARDGKLTLEDMAGGTFTISNGGVFGSLYGTPIINMPQTAVLGLHGV
KERPVTVNGQIVSRPMMYLALTYDHRLLDGREAVTFLKTVKELIEDPKKMLLW
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcgaggtcggctgtttgcgcaaaaagatacattacaccacgccatgtggctgca
tggaaattgccggtgcagaaggttgttcctgcgtacttgtcgcagtaccgttgggcgtct
acgtctgttaaggtgccctccatggcagagtccctgactgagggttctttgaaggagttc
acaaagaaagtcggtgagtttgttgagcaagatgagcttttggccaccattgagaccgat
aagattgatatcgaggttaactcgccagtatctggtacagtcaccaagctaaatttcgaa
ccagaggacactgtcactgttggtgacgagctggcacagattgaagaaggtggtgcacca
gctgatggtggagccaagcctgctgccgaagaatcgaaacctgctgaggaatcgaaacca
gcagagcaagctaagccagctgcaccagctgcggagaaaaaatcagctccagtgaagaag
ccagaatctccaaagcaagaggcatccaacgctgcacaacaagccccatccactgcagcc
ttctcccgtaatgagaacagagtgaagatgaaccgtatgagaatgagaattgctgaaaga
ttaaaggaatctcaaaacaccgcagcatctctaaccacattcaacgaagtcgatatgtcc
gcattgatggaaatgagaaagctatataaggatgaaatcatcaagaagaccggtaccaag
tttggcttcatgggtctattctctaaggcttgtacactggctgccaaggatattccagct
gttaacggtgccattgaaggtgaccaaattgtataccgtgactacacagatatctcgatt
gctgttgccactcctaagggtttggttaccccagttgtccgtaatgcagagtctctatcc
gtgatagagattgaacaagagatcgtcagattgggtcaaaaggccagagatggtaagttg
actttagaagatatggctggtggtacttttaccatatccaacggtggtgttttcggttct
ttgtacggtacaccaattatcaacatgccacaaaccgctgtgttgggtctgcatggtgtg
aaggagagaccagttactgttaacggccaaattgtctctagaccaatgatgtatctagct
ctaacttacgaccacagattgctagatggtagagaagcagtcacattcttgaagacagtc
aaggaattgattgaggatccaaagaagatgttattatggtaa

DBGET integrated database retrieval system