KEGG   Candida glabrata: CAGL0E01287gHelp
Entry
CAGL0E01287g      CDS       T01024                                 

Definition
(RefSeq) hypothetical protein
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cgr  Candida glabrata
Pathway
cgr00020  Citrate cycle (TCA cycle)
cgr00310  Lysine degradation
cgr01100  Metabolic pathways
cgr01110  Biosynthesis of secondary metabolites
cgr01130  Biosynthesis of antibiotics
cgr01200  Carbon metabolism
Module
cgr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cgr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CAGL0E01287g
  Amino acid metabolism
   00310 Lysine degradation
    CAGL0E01287g
Enzymes [BR:cgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CAGL0E01287g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 GCV_H RnfC_N HlyD_D23
Motif
Other DBs
NCBI-GeneID: 2887559
NCBI-ProteinID: XP_445744
UniProt: Q6FVK0
Position
E:120804..122045
Genome map
AA seq 413 aa AA seqDB search
MLSRSAVCAKRYITPRHVAAWKLPVQKVVPAYLSQYRWASTSVKVPSMAESLTEGSLKEF
TKKVGEFVEQDELLATIETDKIDIEVNSPVSGTVTKLNFEPEDTVTVGDELAQIEEGGAP
ADGGAKPAAEESKPAEESKPAEQAKPAAPAAEKKSAPVKKPESPKQEASNAAQQAPSTAA
FSRNENRVKMNRMRMRIAERLKESQNTAASLTTFNEVDMSALMEMRKLYKDEIIKKTGTK
FGFMGLFSKACTLAAKDIPAVNGAIEGDQIVYRDYTDISIAVATPKGLVTPVVRNAESLS
VIEIEQEIVRLGQKARDGKLTLEDMAGGTFTISNGGVFGSLYGTPIINMPQTAVLGLHGV
KERPVTVNGQIVSRPMMYLALTYDHRLLDGREAVTFLKTVKELIEDPKKMLLW
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcgaggtcggctgtttgcgcaaaaagatacattacaccacgccatgtggctgca
tggaaattgccggtgcagaaggttgttcctgcgtacttgtcgcagtaccgttgggcgtct
acgtctgttaaggtgccctccatggcagagtccctgactgagggttctttgaaggagttc
acaaagaaagtcggtgagtttgttgagcaagatgagcttttggccaccattgagaccgat
aagattgatatcgaggttaactcgccagtatctggtacagtcaccaagctaaatttcgaa
ccagaggacactgtcactgttggtgacgagctggcacagattgaagaaggtggtgcacca
gctgatggtggagccaagcctgctgccgaagaatcgaaacctgctgaggaatcgaaacca
gcagagcaagctaagccagctgcaccagctgcggagaaaaaatcagctccagtgaagaag
ccagaatctccaaagcaagaggcatccaacgctgcacaacaagccccatccactgcagcc
ttctcccgtaatgagaacagagtgaagatgaaccgtatgagaatgagaattgctgaaaga
ttaaaggaatctcaaaacaccgcagcatctctaaccacattcaacgaagtcgatatgtcc
gcattgatggaaatgagaaagctatataaggatgaaatcatcaagaagaccggtaccaag
tttggcttcatgggtctattctctaaggcttgtacactggctgccaaggatattccagct
gttaacggtgccattgaaggtgaccaaattgtataccgtgactacacagatatctcgatt
gctgttgccactcctaagggtttggttaccccagttgtccgtaatgcagagtctctatcc
gtgatagagattgaacaagagatcgtcagattgggtcaaaaggccagagatggtaagttg
actttagaagatatggctggtggtacttttaccatatccaacggtggtgttttcggttct
ttgtacggtacaccaattatcaacatgccacaaaccgctgtgttgggtctgcatggtgtg
aaggagagaccagttactgttaacggccaaattgtctctagaccaatgatgtatctagct
ctaacttacgaccacagattgctagatggtagagaagcagtcacattcttgaagacagtc
aaggaattgattgaggatccaaagaagatgttattatggtaa

DBGET integrated database retrieval system