KEGG   Candida glabrata: CAGL0E01287gHelp
Entry
CAGL0E01287g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cgr  Candida glabrata
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CAGL0E01287g
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CAGL0E01287g
  Amino acid metabolism
   00310 Lysine degradation
    CAGL0E01287g
Enzymes [BR:cgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CAGL0E01287g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:120804..122045
Genome map
AA seq 413 aa AA seqDB search
MLSRSAVCAKRYITPRHVAAWKLPVQKVVPAYLSQYRWASTSVKVPSMAESLTEGSLKEF
TKKVGEFVEQDELLATIETDKIDIEVNSPVSGTVTKLNFEPEDTVTVGDELAQIEEGGAP
ADGGAKPAAEESKPAEESKPAEQAKPAAPAAEKKSAPVKKPESPKQEASNAAQQAPSTAA
FSRNENRVKMNRMRMRIAERLKESQNTAASLTTFNEVDMSALMEMRKLYKDEIIKKTGTK
FGFMGLFSKACTLAAKDIPAVNGAIEGDQIVYRDYTDISIAVATPKGLVTPVVRNAESLS
VIEIEQEIVRLGQKARDGKLTLEDMAGGTFTISNGGVFGSLYGTPIINMPQTAVLGLHGV
KERPVTVNGQIVSRPMMYLALTYDHRLLDGREAVTFLKTVKELIEDPKKMLLW
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcgaggtcggctgtttgcgcaaaaagatacattacaccacgccatgtggctgca
tggaaattgccggtgcagaaggttgttcctgcgtacttgtcgcagtaccgttgggcgtct
acgtctgttaaggtgccctccatggcagagtccctgactgagggttctttgaaggagttc
acaaagaaagtcggtgagtttgttgagcaagatgagcttttggccaccattgagaccgat
aagattgatatcgaggttaactcgccagtatctggtacagtcaccaagctaaatttcgaa
ccagaggacactgtcactgttggtgacgagctggcacagattgaagaaggtggtgcacca
gctgatggtggagccaagcctgctgccgaagaatcgaaacctgctgaggaatcgaaacca
gcagagcaagctaagccagctgcaccagctgcggagaaaaaatcagctccagtgaagaag
ccagaatctccaaagcaagaggcatccaacgctgcacaacaagccccatccactgcagcc
ttctcccgtaatgagaacagagtgaagatgaaccgtatgagaatgagaattgctgaaaga
ttaaaggaatctcaaaacaccgcagcatctctaaccacattcaacgaagtcgatatgtcc
gcattgatggaaatgagaaagctatataaggatgaaatcatcaagaagaccggtaccaag
tttggcttcatgggtctattctctaaggcttgtacactggctgccaaggatattccagct
gttaacggtgccattgaaggtgaccaaattgtataccgtgactacacagatatctcgatt
gctgttgccactcctaagggtttggttaccccagttgtccgtaatgcagagtctctatcc
gtgatagagattgaacaagagatcgtcagattgggtcaaaaggccagagatggtaagttg
actttagaagatatggctggtggtacttttaccatatccaacggtggtgttttcggttct
ttgtacggtacaccaattatcaacatgccacaaaccgctgtgttgggtctgcatggtgtg
aaggagagaccagttactgttaacggccaaattgtctctagaccaatgatgtatctagct
ctaacttacgaccacagattgctagatggtagagaagcagtcacattcttgaagacagtc
aaggaattgattgaggatccaaagaagatgttattatggtaa

DBGET integrated database retrieval system