KEGG   Candida glabrata: CAGL0E03916gHelp
Entry
CAGL0E03916g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cgr  Candida glabrata
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cgr00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:371422..373440
Genome map
AA seq 672 aa AA seqDB search
MISVNDGNIQMDKDGNIPLIASIDVGTTSSRVIFFNKQGQEVAKHQIEYSTSASTQKYAV
HGSRRQSIKDQTKMANPEKDKPVFTSEGIAIKENEYLTIEEFHGANEGPTLKFPKPGWVE
CNPMNVLVNVVQCLGTTYELLDNLNNDRAQNNLPLYRVDCVGVANMRETTIVWSKKTGMP
IVDYGIVWNDTRTLDLVKRKKKETEKEKRLRMKDKTGLSVFSTYFSCSKLVWLLENEPEV
KKAYEAGDLMFGTVDTWLIYHLTASNAFVSDVTNASRTGFMNLDTRDYDDELVEFWGIDR
NKINFPKIVSSAEYYGDLSIPKLFKSQVPGHIWELLLKYTEGEFQVPIQGCLGDQSASLV
GQMAFKPGAAKCTYGTGCFLLYNTGCKKLISKHGALTTFSYWFPYLEEKENPEYGAPHFA
LEGSVAVAGAVVQWLRDNLRLIPKAEDVGPIANSVPDSGGVVFVPAFSGLFAPYWDPEAR
GTIMGMSQYTTASHIARAAVEAVCFQARAILLAMSNDAMGEAEKDSTFKTEISEEGSYQK
SLLSTLAVDGGMSRSDEVMQIQADILGPCVKVRRSPTAECTALGAAVAANMAYERPQDRV
LWRDLQDAKNWIFYEGMTKSEYQAKETKQNLKIFRSQSTDEDRHKHWIQWEAAVKRSKGW
LKDVEGEHPVVA
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgatttccgttaacgacggtaatatccagatggataaagacggtaacatccctctgatc
gcttctattgacgtgggtactacatcttcccgtgtcattttcttcaacaaacagggtcaa
gaagtcgctaagcaccaaatcgaatactctacatctgcctctactcagaaatatgctgta
catggttcacgtagacagtccatcaaggaccaaaccaagatggctaacccagaaaaggac
aaaccagtgttcacaagtgaaggtattgccatcaaggaaaacgagtacttgaccatcgaa
gaattccacggtgctaatgaaggaccaactttgaaattccctaaaccaggctgggtcgaa
tgtaacccaatgaatgtcttggttaacgttgttcagtgtctaggtactacttacgagctg
ctcgataacttgaacaacgaccgtgcccaaaacaacctgccgctatacagagtcgactgt
gtcggtgtagctaatatgagagaaactactattgtttggtctaagaagaccggtatgcca
attgtggattacggtattgtctggaatgacacccgtactctagacttggttaagagaaag
aagaaagaaactgaaaaggagaagagattacgtatgaaggacaagaccggtttgtctgtt
ttctctacatacttctcttgttcaaaacttgtatggcttttggagaacgaaccagaggtc
aagaaggcttatgaagctggcgacttgatgttcggtactgttgatacttggctgatttac
catttgaccgctagcaacgcttttgtctctgatgtaactaatgcaagcagaactggtttc
atgaacttggataccagagattatgacgatgaattagttgaattctggggtattgacaga
aataagatcaacttcccaaagatcgtgtcatctgctgaatactacggtgacttgagcatt
ccaaagttgtttaagtctcaagtcccaggacatatttgggaattgttattgaaatacacc
gaaggtgaatttcaagtaccaattcaaggctgtctaggtgaccaaagtgcctcattggta
ggccagatggcttttaaacctggtgccgccaaatgtacctatggtacgggttgtttctta
ctatacaacactggctgcaagaaattgatttctaagcatggtgctttgacaactttctct
tactggttcccatacttggaagaaaaggaaaacccagagtatggtgccccacactttgcc
ttggaaggttccgtcgctgtcgctggtgccgttgtgcaatggttacgtgacaacttgcgt
ttaattccaaaggctgaagatgttggaccaattgccaattctgttccagactctggtggt
gttgtttttgttccagcattcagtggtctattcgcaccatactgggatccagaggctaga
ggtaccatcatgggtatgtctcaatacacaaccgcttctcacattgctagagcagctgtt
gaagctgtttgtttccaagcccgtgccattctattggctatgagtaacgatgccatgggt
gaagccgagaaggatagtacttttaagactgagatcagcgaagagggttcatatcaaaag
tctttactatctacattggctgttgatggtggtatgtcccgttcagatgaagtcatgcaa
atccaagctgacatcttgggtccatgtgtcaaagttagaagatctccaactgctgagtgt
actgctttaggtgctgcagttgccgctaacatggcctacgaaagaccacaagaccgtgtc
ctatggagagatcttcaagacgctaagaactggattttctatgaaggtatgactaaatcc
gaatatcaagctaaggagactaagcaaaacttgaagattttcagaagccaatctactgat
gaagacagacacaagcactggattcaatgggaagctgctgttaagagaagcaaaggctgg
ctaaaggatgttgaaggtgaacatcctgtagtagcatga

DBGET integrated database retrieval system