KEGG   Candida glabrata: CAGL0E06336gHelp
Entry
CAGL0E06336g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K12272  
signal recognition particle receptor subunit beta
Organism
cgr  Candida glabrata
Pathway
Protein export
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    CAGL0E06336g
Secretion system [BR:cgr02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   CAGL0E06336g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:637212..637976
Genome map
AA seq 254 aa AA seqDB search
MVASSLMIALVLVILTTLLIAFQVKKTLVSGHKSSQSSSYVKKVPTIIIAGPSYSGKTSL
FHKLTSDETNAKLLTVMSQEPSFALKYKGTMTTLADYPGHVKLAYKLKNGIIDLKGNLKG
ILFVLDSTIDPKNITETAEYLTEILLILEKIREPIDILIACNKNESFTARQPLKIKEALE
NEITRIFERKKKSLGNIERDIGDVDEINENLDLSFDISKGFKFDYLEGNVEVLAGSVHKN
KITTWQEWVGSHLV
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggttgcgtcaagtttaatgattgcattagtccttgtgatactaactacattactgata
gccttccaagtcaaaaagacattggtaagtggtcacaagagtagtcaaagtagcagttac
gtgaaaaaggttcctaccataataattgctggacctagttattccggtaagacaagcttg
ttccataaattaactagtgatgaaacaaacgctaagttattaacggtcatgtctcaagag
ccgtcatttgcattaaaatataaaggaactatgacaactctggctgattatcctggtcat
gttaagttggcatataagttgaaaaatggtataatagacttgaaaggtaatttgaaaggt
attttgtttgttctagacagtacaatcgatcctaagaatataactgaaacagcagagtac
cttaccgaaattttgctaatattggaaaaaattcgggagccaattgatatattaatagcc
tgtaacaagaatgaatcattcacagcaagacagccattgaaaatcaaagaagccttagaa
aatgagattactaggatatttgaaaggaaaaaaaaatctctcggtaatatagaacgtgat
attggtgacgttgatgaaataaacgaaaacttggatctatccttcgatatttcaaagggg
tttaagtttgactacctcgagggaaatgttgaagtattggcgggaagcgtacataagaat
aaaattacaacatggcaggagtgggttggaagtcatctggtttga

DBGET integrated database retrieval system