KEGG   Candida glabrata: CAGL0E06424gHelp
Entry
CAGL0E06424g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
cgr  Candida glabrata
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CAGL0E06424g
Enzymes [BR:cgr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     CAGL0E06424g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:644263..645159
Genome map
AA seq 298 aa AA seqDB search
MAFARFARPTQRFLPFAIGAVAVTAGALYLNGWNTIKNENPKVFIGDRKWIDLELEKIIE
ESHDTKRFFFKLPTDDSVSGLTLASAVLTKFMTPKGNPVIRPYTPVSDLSEKGYIEFVIK
HYEGGKMTDHLFQLKPKDTLAFQGPIPKWQWKPNSFDTITLLGGGTGITPLYQLVHHITQ
NKEDKTKINLFYGSKTPSDILLKKELDDLQKKYPEQLNIQYFVDKDDTGKFDGNKGFITK
DFLAKNAPGPKEKTQVFVCGPPPFMDSLSGQKKSPMEQGDLTGALKDLGYSQDQVFKF
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggcctttgctagatttgcacgccctacacagagattcttaccatttgcaattggtgct
gttgccgtcacagctggtgctctatatttgaatggttggaataccataaagaatgagaac
cctaaggtctttatcggtgatagaaaatggattgacctagaattggaaaagatcattgag
gaatctcatgacactaagagatttttcttcaaactaccaaccgatgattcagtcagtggt
ttgactcttgcatctgctgtgctaacaaagtttatgactccaaaaggcaaccctgttatc
agaccatacaccccagttagtgacttgtcagaaaagggttacatagagtttgtaatcaag
cattatgaaggtggtaagatgactgaccacctgttccaattaaagccaaaggacactttg
gcttttcagggccctatccctaaatggcaatggaagccaaactcctttgatactataact
ttgctaggtggtggtactggtattactccattatatcaattagttcaccacattacccaa
aataaggaagacaagactaaaatcaacctattttacggcagtaagacaccatctgacatc
ttgttaaagaaagaattagatgacttacagaagaaatacccagaacaactcaacattcaa
tactttgttgacaaggacgacaccggaaagttcgatggaaataagggcttcatcaccaag
gatttcttagctaagaatgccccaggtccaaaggaaaaaacgcaagtttttgtttgcggt
cctccaccattcatggattctttatctggtcaaaagaagtcaccaatggaacaaggtgac
ctaactggtgctttgaaagatttgggttattctcaagatcaagtattcaagttttag

  All links  
No link information was found.   
DBGET integrated database retrieval system