KEGG   Candida glabrata: CAGL0F00253gHelp
Entry
CAGL0F00253g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K01656  
anthranilate synthase / indole-3-glycerol phosphate synthase [EC:4.1.3.27 4.1.1.48]
Organism
cgr  Candida glabrata
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cgr01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cgr00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(31114..32568)
Genome map
AA seq 484 aa AA seqDB search
MKRVVLIDNYDSFTWNIYEYLCQEGADVQVFRNDKVTVDEVVALKPDVLVISPGPGHPST
DSGISRDAIRQFAGKLPIFGVCMGQQCMFEVFGGEVAYAGEIVHGKTSPIFHDNKGFFKN
VPQGVAVTRYHSLAGTPESLPDVLEVTARTEQGIIMGVRHKKYTIEGVQFHPESILTEEG
HLMIQNILKVTGGTWDEYEANEKNTSTGNNQESILDKIYAKRKSDIASQSKVPGFTMRDM
EFNYKLGLAPSQIDFYSKIKSAKQRAVVLSEIKRASPSKGDICIDALATEQGLRYARAGA
SAISVLTEPHWFKGSLQDLINIRRALDIEFKTHPEDRPCLLRKEFIFSEYQILEARLAGA
DTVLLIVKMLGEEELKRLYNYSKTLGMEPLVEVNCEKELEKALSLDAKVIGVNNRDLHSF
NVDLNTTSSLINSVPAETMLIALSGITSPSDADKYKEEGVRGFLVGEALMRTSEPESFIK
ALCQ
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagagttgtattgatcgataattatgactccttcacttggaatatctacgagtat
ctgtgccaggaaggtgcagatgtccaagttttccgtaatgataaagttactgtcgatgag
gttgtggcgttaaaaccagatgttctagttatttctcctggacccggtcatccatctact
gattctggtatctctcgagatgctattagacaatttgctggtaaactacctatctttggt
gtctgtatgggccagcaatgtatgtttgaagtttttggcggtgaggtcgcctatgctggt
gaaattgtccatggtaagacatccccaatattccacgataataaaggcttcttcaaaaat
gttcctcaaggtgtggcagtaaccagataccattcattggctggtactcctgaatcgttg
ccagatgtcttagaagtcacagcaagaactgaacagggtattatcatgggtgtaagacat
aagaagtatactatagaaggtgtacagttccatccagagtctatcctaaccgaagaaggt
catttgatgattcaaaatattctaaaagttacaggtggtacttgggatgaatacgaagcc
aacgaaaaaaacacctcaactggcaataaccaagagagtatcttggataagatatatgcc
aaacgtaaatctgacatagcttctcaaagcaaagttccagggttcactatgagagacatg
gagttcaactacaaattgggtctagcaccaagccaaattgatttttattccaagataaag
tccgctaaacaaagagctgtggtgctatccgaaataaagcgtgcatctccttcaaagggt
gatatatgcatagatgcccttgcaactgaacaaggattaagatacgctagagcaggtgct
tctgcgatctcagtccttacagaaccacactggtttaaaggctctctacaagatctaatt
aacattcgtagagctcttgacattgaatttaaaacccaccctgaagacagaccatgccta
ctgagaaaagagttcatattttcagagtaccaaatactagaggctagattagccggcgcc
gatactgttcttttaatcgtgaaaatgctaggtgaggaagaattgaaaagactatacaat
tactcaaaaacattgggtatggaaccgttagtggaagttaattgcgagaaggaattagaa
aaagcattgagcttggatgcaaaagttattggtgtaaacaatagagacttacactctttt
aatgtcgatttaaataccacaagctcactgattaatagtgtacccgctgaaacaatgcta
attgcgttgtctggtatcaccagtccttctgatgctgataagtataaggaggaaggcgtt
cgtggattcttggtgggcgaagcgttgatgagaacttctgaaccagaatcattcatcaaa
gctctttgccaatga

DBGET integrated database retrieval system