KEGG   Candida glabrata: CAGL0F00495gHelp
Entry
CAGL0F00495g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
cgr  Candida glabrata
Brite
Protein kinases [BR:cgr01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   CAGL0F00495g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(45806..53176)
Genome map
AA seq 2456 aa AA seqDB search
MSSLKLEDRDSSESAALLRSAVIGTPNEQSMSPVPILDYDSGSASNFTKGESTMLESDVL
PDLESLPMLMDYILELLKSPNVRLRLSATNKLKTVLISLAHEISIEQFQSFNHKLDNKIY
QMVHSKDVRSQIAGVLSVDCLIWYYSQTEELPNYTTKLAGYLKVLIPSKNLDLMKQAIEI
LGKLAIPTSSITSEFLQHEVKNCIEWLTTSPESKFSTQTQELRKHASLQIITVLSKNSPT
VLYPYINSILDNIWRALRDPDNLMRFDAAKVVGCCLRIISKRDESACKEWIIHLMQGCAF
GLTLKTTDAIHATLLVYHELLELDSECLNDFFDDIYYVTMSFKDHRSPLIREEICSIVSL
LASLNPVMFSNLYLDKVMNHFLDLLQNITTYNISNKERSHIFISIGDIADNVGEMMFEFL
EPTLITLKESLRTRYRTRKDYEEGVFYCIGKLSSAIREDLQKYLEGGLLKLILECPLSDH
MQKTLSILSANTPDYAKHIDKELLDLLCIHLSGDHFIEPGTPIKGKPFSPNAARVWRNQN
VYHQIGIANDDLNDAQILIQTLKIFRETKFKVVLTEFVKNVIIYYIEHENQLVRKLAALT
SCEIFINDSICKETSLNSLNTVSEVLEKLLTVAVTDLNPEIRLEILKHLSSPFDSHLAKP
ENLQLLFTALNDELIAIQIEAMKIIGRLVTVNPAYVIPSLRNYLLSLITELKYPNFSTRK
DEAATLLCTLIQSSKNVTKPYIEPILNVLLPKLDDNSSTVASIALKAIGALAVVGGEDMK
QNNSTLFPLMIKTLQDQSNSFKRDAALKSLGQLAASSGYVIRPFLDYPDLLSVLIGILRA
ESAQNIRRETVRLIGILGALDPHKQRDVEVNLKTKLAVEQNQPPIDVALLMQGNSPSNDD
YYPTVVIVSLMKILKDPSLSSYHTSAVQAIMQIFQIMGLKCISFLDKIIPGIISVMHMCP
SNLLDFYFQQLCQLTVIMKQHIRPYVDEIYDAIIEFFRFENLQVTILSVINSLCYALKGE
FKRFIPLTLNLLLGVLEKDRSAGRENSIRVLQSFVIFDTNLELYAHTILPSILKLTEFST
GHLRKAAIITVGKLSKCINLSEMASRIVHSLARVLYVNDDELREVTLNTLSLLLLRLKRN
YIIFVPVVNRILVDCSIKHAIYDDLVTKLLNGEALPNTIILEDDTEQKQLSLSNIAETTD
KKLPINQNGLKSVWDCSQLRTKEDWQDWIRRLSIQFLKESPSPALRTCANLASIYHPLAR
ELFNASFSSLWSELYTQYQESLIGSLCSALSSPQNPPEIHQVLLNLIEFMEHDDKPLPIP
INTLGQYAERCHAYAKALHYKEVKFIKEPVSSTIESLISINNQLHQTDAAIGILKHAQQH
HSYQLKETWYEKLQRWDDALDSYTKRAEAGDNSIEVTVGRMRSLHALGEYETLSQLAENK
WKTSNLQVRKKIAPLAAGAAWGLGEWDEIEKYISVMKENSPDKEFFDAVLCLHRNRFDEA
EKHIFAARDLLVTEISALINESYTRAYGVVVRTQIIAELEEIIDYKKASHNSAKRTHYRN
LWDQRLLGCQKNVDIWQRILRVRSLVVKPKQDMHIWIKFANLCRKSGRMSLAQKALYSLL
EDGSDPNQPNTAKAPPPVVYAQLKYLWATSSHEEVLHHLIGFTSRMAHDLGLDPSNMIAQ
SVPQNATVAPQHIETYTKLLARCFLKQGEWRVAIQPNWRVQNPDAILGSYLLATHFDKNW
YKAWHNWALANFEVISMLTSKNKNEDTNGAQVNGDWRIENSIMGTDYFSNDESKFSPEII
QRHVVPAIKGFFHSISLLKASSLQDNLRLLTLWFTFGGVEEANKAMHDGFGMIKIDNWLE
VLPQLISRIHQPNPVVSKALLSLLSDLGKAHPQALIYPLTVAIKSESVSRQKAALSIIEK
MRIHSPILVDQAELVSHELIRLAVLWHELWYEGLEDASRQFFGEHNTEKMFATLEPLHEL
LNCEPETLREATFKKSFGRDLNDAYEWVLNYKRTKDVSNLNQAWDIYYNVFRRISRQLPQ
LQSLELQYVSPKLLAAHDLELAVPGTYSATKNVIKISYFEPTLTVISSKQRPRKIWIHGS
DGVEYQYVLKGHEDIRQDNLVMQLFGLVNTLLRNDSECFQRHLDIQQYPAIPLSPKSGLL
GWVPNSDTFHVLISEHRDAKKIPLNIEHWVMLQMAPDFDNLTLLQKIEVFTYALDSTKGQ
DLYKILWLKSRSSEAWLDRRTTYTRSLAVMSMVGYILGLGDRHPSNLMLDRTTGKVIHID
FGDCFEAAILREKFPEKVPFRLTRMLTFAMEVSGIEGSFRITCEHVMRVLRANKESLMAM
LEAFAFDPLIHWGFDLPPQKITEMTGIQLQLSNTNELLRRGAITLEQANKMEKEQQAEIK
NARALLVLRRIINKLTGNDFKRCKDLGINEQVDKLIQQATSVENLCQHYIGWCPFW
NT seq 7371 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagtttgaaactagaagatagggatagcagtgaaagtgccgcgttactccgatct
gctgtaattggtaccccgaatgagcagagcatgtcaccggttcctatactcgactatgac
tctggttctgctagtaattttacaaagggggaatcaactatgttggaaagtgatgtgctt
cccgatttggaatcattgcccatgctcatggactacattttagaattattgaaaagtccg
aacgttagactaagactatcggctacaaataagctaaagaccgtcttaatatcattggct
catgagatatcaatagagcagtttcagagcttcaatcataagttggacaataagatttac
cagatggttcacagtaaggatgtgagaagtcaaattgcaggtgtgctatccgttgactgt
ttaatatggtattattcacaaaccgaagaacttccaaattatactactaaacttgctgga
tatttaaaggtacttataccttccaaaaacttggatttaatgaagcaagcaattgagata
ctaggcaagttagctattccaacgagctcaataacttctgaatttttacagcacgaggtt
aaaaactgtatagagtggctaacaacatcacctgaaagcaaattctcaacccaaacccaa
gaactaaggaagcacgcgtcattacaaataattactgtattgagtaaaaactctcctact
gtgttatacccatacatcaattctattcttgacaatatatggcgagcactacgagatcca
gataatttgatgcgttttgatgccgctaaagtagttggctgttgtttgagaatcatttcg
aagagagatgaaagtgcatgtaaggaatggataatacaccttatgcaaggttgtgcgttt
ggactgactttaaaaacaacagatgctattcatgcaactttgttggtttatcatgagctt
ctcgaactggatagcgaatgcttaaatgacttttttgatgatatctactacgttactatg
tcatttaaggatcataggtcaccattaattcgggaagaaatatgtagtattgtatcactg
ttggcatcacttaatccggtaatgttttctaatctttatttggacaaggtcatgaaccat
ttcctagatttacttcaaaatattacaacttacaacatttctaacaaagaaagatcgcat
atctttatctctattggtgatattgctgataatgttggtgaaatgatgtttgaattttta
gaacctacattaattacattgaaggaaagcctgagaacaaggtacaggacaagaaaagat
tacgaggagggtgtattctattgtattggaaaactatcttctgctatcagagaagatcta
caaaaatatttggagggcggtctattaaaattaattctagaatgtcctttatcagatcat
atgcaaaaaacactttctattttgagtgctaacacacctgactatgcaaagcatattgat
aaggaattgctagatctgttatgtatccatctttctggtgatcattttatagaacctggc
acgcccataaaaggtaaaccgttttcaccaaatgcggcaagagtatggagaaatcaaaac
gtttatcatcaaatcggaatagcaaatgatgacctaaatgacgctcaaattctgatacag
actttgaagatattccgcgaaactaaatttaaggtagtattaactgagtttgttaagaat
gtgataatatactatatcgaacatgaaaaccaacttgtgcgaaaactagctgctttaaca
agttgtgaaatttttattaatgatagcatatgtaaagaaacttctctcaattctttgaat
actgtatctgaagtactagagaaattgttaacagttgcggtgactgacttgaatcctgaa
attagactagaaatattaaaacatctctcatccccatttgactcacatttggcaaaacca
gagaatcttcagctgctgttcacagctctaaatgacgaactgattgctatccaaattgag
gctatgaaaataattggtagactagtcacggttaatcctgcatatgttattccttcctta
agaaactacttattgtctcttattactgaattgaagtatccaaatttttcaactagaaaa
gatgaggcagccacattgctatgtactttaatccaatcaagcaaaaatgttacgaaacct
tatattgagcccattttaaacgttttattaccaaagttagatgacaactcctcaaccgta
gcatccattgcacttaaagcaattggtgcactagcggtggttgggggtgaagatatgaag
cagaataactcgacactatttccgttgatgataaaaacactccaggatcaatcaaactcc
ttcaaaagagatgcagcattgaaatcattgggacaattggcagcctcttcaggatatgtt
atacgtccatttttagactatcctgatctgttaagtgtgttaattggtatcttaagggca
gaaagtgcacaaaatattagaagggaaactgttagattaatcggtattttaggtgcgctt
gacccacacaaacaaagagatgttgaagttaacctaaaaacaaagcttgcagtagaacag
aatcaacctccaattgatgtggcattattaatgcaaggtaattctccatctaatgatgac
tattatcccacagtcgtgattgtttccctcatgaaaattctgaaggatccgtcattatca
tcctatcatacatctgcagtgcaggccataatgcagatattccaaattatgggattgaaa
tgtatttcattccttgacaagattatacctgggataatttcagtcatgcatatgtgtccc
agtaatcttttggatttttatttccaacagctatgtcaattgacagttataatgaaacaa
catatacggccttatgttgacgaaatatatgatgcaattattgagttttttcgatttgag
aacttacaggtcacaatattatctgttataaattctctatgttatgcactaaaaggtgag
tttaaaagatttatccctttaactttaaatttattgttaggagttctagaaaaagatcgt
tcagctggaagagaaaactcaattagagttcttcagtcttttgtgatatttgacacaaat
ctagagttgtatgctcatactatattaccatcaatattaaaacttactgaattttctacc
ggccatcttagaaaggctgccatcataacggttggtaaactttcaaaatgtattaattta
tcagagatggcgtcacgaatagttcactcattggcaagggtattgtatgttaatgatgac
gaacttagggaagtgactctgaatacactatctttgttgttactacgtttgaaaagaaac
tatatcatatttgtcccagtagtcaatagaattttagttgattgctctataaagcacgcc
atatatgatgatttggttacaaaattacttaatggagaggctcttccgaatactatcata
ttggaagatgatactgagcagaaacaattatccttgtctaatatagctgaaactactgat
aaaaaacttccgataaaccaaaatggtttgaaatctgtttgggactgttctcagcttaga
accaaagaagactggcaagattggataaggcgtttatctatccagttcttaaaggagtca
ccatctccagcgctacgcacatgtgctaatttggcaagcatttatcaccctctagcaagg
gaactattcaatgcctctttctccagcctttggtctgaattatacactcaataccaagaa
agtttgatcggatctctatgtagtgcattatcatcaccacaaaaccccccagaaatacat
caagttttattgaacttaatagaattcatggaacatgatgataaaccgttgccaatccca
ataaacactttaggacaatatgctgaaagatgtcacgcgtatgctaaagcactacattat
aaagaagtaaaatttataaaggagccggtaagctctacgattgagtccttgattagtatt
aacaatcaattacatcaaactgatgcagctataggtattctaaaacatgcacagcaacat
cattcttatcagttgaaggaaacatggtatgaaaagctccaaagatgggatgatgcacta
gactcttataccaaaagggcggaagcaggagataactcaattgaagttactgtaggtaga
atgaggtcattacatgctttgggtgaatatgaaaccttgtctcaactggcagaaaacaaa
tggaagacatctaatttgcaagtacgaaagaaaattgcacctctagctgctggggcggct
tggggtttaggtgaatgggatgagattgaaaagtatattagcgtaatgaaagaaaattcg
cctgataaggaattctttgatgcagttctgtgtttacacagaaacagatttgatgaggct
gagaaacatatatttgctgctcgcgacttattggttacagaaatatcagcactaattaat
gaaagttatactagagcttatggtgttgttgttcgtacgcaaatcatagctgaactcgaa
gaaataattgactataagaaggcatctcataactcggcaaaaagaacacattaccgcaat
ttatgggatcaacgtctactgggttgtcagaaaaatgttgacatttggcaaagaattcta
cgagtgcgctctttggtcgttaagccaaaacaggatatgcatatttggataaagtttgct
aatttatgtcgtaagtctggcagaatgagtttggctcaaaaagctctttactcattacta
gaggatggtagtgatccaaatcaaccaaatactgcgaaggcaccaccaccagtagtttac
gctcaattaaaatatctgtgggcgacatcttcccatgaagaggtcttgcatcatttaatc
ggattcacttcaagaatggctcatgatttgggtttggaccctagtaatatgatagcgcag
agcgtaccgcaaaatgcgacggttgctccgcagcacattgagacatacacaaaattgcta
gcaaggtgctttttgaaacagggagaatggagagttgcaatacaacccaattggagagtg
caaaatcctgatgcgattttgggttcttacttattagcaacacactttgataagaattgg
tataaggcatggcacaactgggctttagccaattttgaggttattagtatgctaacgtca
aaaaataaaaatgaggacacgaacggcgctcaagttaatggggattggaggatcgaaaat
agtataatgggaacagattattttagtaacgatgaaagtaagttctcccctgaaattata
cagcgtcacgttgttcctgctatcaaaggtttctttcattcaatatccctccttaaggca
agttcacttcaagataatttacgtcttctgacattatggttcaccttcggtggagtagaa
gaagctaataaagcgatgcatgatggatttggtatgattaaaattgacaattggttagaa
gtcctaccacaattgatatctagaatacatcaacctaatcctgttgtgagtaaagcgttg
ctttcacttctttctgatttggggaaagcgcatccacaagcactaatttatcctttaact
gttgcaattaaatccgagtctgtttcgaggcagaaagctgctttgtccataattgagaag
atgaggatacatagtcctatcttagttgaccaagcggagttagtaagtcatgaactgatc
aggttggctgttctatggcacgaattatggtatgaaggactggaggatgcaagtagacaa
tttttcggagagcataataccgaaaaaatgtttgcaacgttagaacctcttcatgagtta
ctgaactgcgaacccgagactttacgagaggccacatttaagaaatccttcggcagagat
ctaaatgatgcttatgagtgggttctcaactacaagcgcacaaaagatgtaagcaactta
aatcaagcttgggatatatattataacgtctttagaaggattagcaggcaattgccacaa
ttgcaatcattggaacttcaatacgtttctccaaaactattagcagcacatgatttggaa
ttagctgtccctggaacatactcagccactaagaatgtgatcaagatatcttattttgaa
ccgacattaacagtcatatcgtcaaaacagagacctagaaagatatggattcatggtagt
gacggtgttgaataccagtatgtcttaaaaggtcacgaggatattcgacaagacaactta
gtaatgcagttatttggattggtaaataccctcctaagaaatgattctgaatgtttccaa
agacatttggacatacagcaatatccagctattccattatctcctaaatctggtttattg
ggctgggttcctaacagtgacacttttcatgtacttattagcgaacaccgtgatgcaaag
aaaattcctctcaacattgagcattgggttatgttgcagatggcaccagactttgacaat
cttactctgcttcaaaagattgaagtatttacttatgctttagatagtacaaaaggtcaa
gacctgtataaaattttgtggctgaaaagtagatcatcagaggcatggctggatagaaga
acaacatacacaagatcactagctgttatgtctatggttggttatattcttggtctaggt
gatcgtcacccaagtaatttaatgttagacagaacaacaggtaaggtaattcatatcgac
ttcggtgattgttttgaagctgctatacttagggagaaattcccagagaaagtaccattc
agattgactagaatgcttacattcgcaatggaggttagcggcatagaaggaagcttcaga
ataacttgtgagcacgtaatgagagttttgagggcaaacaaagaatctttaatggccatg
ttagaagcatttgcatttgatccattaatccattggggctttgatttaccaccgcagaaa
ataacagaaatgactggcattcagttgcaattaagtaacaccaacgaattgctacgtaga
ggagcaattactttagagcaagctaataaaatggaaaaagagcagcaagcggagatcaag
aatgctagagcattgttggttcttcggagaatcatcaacaagttaactggtaacgatttt
aaaaggtgtaaggacctcggaattaatgaacaagttgataagttaatccagcaagctact
tctgtggaaaatttatgtcaacattatatcggttggtgtccattttggtaa

DBGET integrated database retrieval system