KEGG   Candida glabrata: CAGL0F04719gHelp
Entry
CAGL0F04719g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
cgr  Candida glabrata
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CAGL0F04719g
Enzymes [BR:cgr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     CAGL0F04719g
Glycosyltransferases [BR:cgr01003]
 Polysaccharide
  Storage polysaccharide
   CAGL0F04719g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:475180..477294
Genome map
AA seq 704 aa AA seqDB search
MSRDLKNNLLFEVATEVANRVGGIYSVLKSKAPVTVAQYKDNYHLIGPLNRATYQSEVDL
LDWNDPSIFSDELKPIQQTLQSMASRGVRFEYGRWLIEGAPRVILFELDSVRGYLNEWKG
DLWSLVGIPSPENDWETNDSILLGYTVAWFLGELAHLDSKHAIIAHFHEWLAGVALPLCR
KRRIDVVTIFTTHATLLGRYLCASGDFDFYNGIEHVDVDHEAGKYNIYHRYCIERAACHS
ADVFTTVSQITAFEAEHLLKRKPDGILPNGLNVVKFQAFHEFQNLHALKKEKINEFVRGH
FHGSYDFDLDNTVYFFIAGRYEYKNKGADMFIEALARLNYRLKVSGSKKTVVAFIIMPAK
NNSFTVEALRSQAVVKSLENTVDEVTRSIGKRIFDHAMKFPHNGITNELPTNLDELLKPS
DKVLLKKRVLALRRPWGELPPIVTHNMVDEGQDLILNKIREVQLFNNASDRVKMIFHPEF
LNANNPILGLDYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGAYMEDL
IETNQAKDYGIYIVDRRFKAPDESVEQLVDYMEEFVKKTRRQRINQRNRTERLSDLLDWK
RMGLEYVKARQLALRRAYPEQFKQLVGEELSDLNMESLTGGKKFKISRPLSVPGSPKDAR
SNSAVYMTPGDLGTLQEANNVDDYFNLSVSGDGDDDDENYAEHN
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgtctagggatttgaaaaacaatttgttgtttgaagtggccactgaggtggctaacagg
gttggtggtatttactctgtgctgaagtcaaaggcacctgtcacagtggcccaatacaag
gacaattaccatctaataggtcctttaaacagagctacttaccagagcgaagttgatttg
ttggattggaacgatcctagtatcttttccgatgaattgaaacctatccagcagactttg
caatccatggcaagtcgtggtgtcaggttcgaatacggtagatggctgattgaaggtgcc
cctagagttattctttttgagctagactcagtacgaggctatctaaatgaatggaaggga
gacttatggtccttagttggtatcccatctcctgaaaacgattgggaaaccaatgactcc
atcttgctaggttacaccgtggcttggttcctaggagagttggcccacctagactccaaa
catgcaatcattgcccatttccacgaatggttggccggtgttgccctacctctatgtaga
aagagaagaattgacgtggtaacaatcttcaccacccacgcaactttgctgggaagatac
ctatgtgcgtctggtgatttcgatttctacaacggtattgaacatgttgacgtcgaccac
gaggctggcaaatacaacatttatcacagatattgtattgaaagagccgcttgccattct
gctgatgtcttcacaacagtgtcccaaattaccgctttcgaagccgagcatctgctaaag
agaaagccagatggtattttgccaaatggtttgaatgttgtcaagttccaggctttccat
gaattccaaaacttgcatgctttgaagaaggagaagattaacgaatttgtcagaggccat
ttccatggtagttacgattttgatctggacaacactgtctatttcttcattgccggtaga
tacgaatacaaaaataagggtgctgatatgttcatagaggctctggccagattgaactac
agattaaaagtttcaggatcaaagaaaaccgttgtggctttcattatcatgcctgcaaag
aacaactcattcactgtagaagctctaagaagtcaagctgtagtgaaatctttggaaaac
accgttgatgaagtcaccagatcaatcggtaagagaatatttgatcatgcaatgaagttt
cctcacaatggtatcacgaatgaacttccaaccaatttggacgaattactaaagccttcc
gacaaggtgctattgaagaagcgtgttcttgctcttagaaggccttggggtgaactacct
ccaattgtcactcataacatggttgatgaaggccaagatttgatcttgaacaagattaga
gaagttcagttattcaacaatgcaagtgatagagttaaaatgattttccatccagaattc
ctgaatgccaacaacccaattctaggtttggattatgatgaatttgtacgtggctgtcac
ttaggtgtcttcccatcatattatgaaccatggggttacactccagctgaatgtacagtc
atgggtgttccttccataactaccaacctttccggttttggtgcctatatggaagacctt
attgaaacaaatcaagctaaggattatggtatttacattgtagaccgtcgtttcaaggcc
ccagacgagtcagttgaacaactagtggactacatggaagagtttgtcaagaagaccaga
agacagagaattaaccaaagaaacagaaccgaaagactatctgacctattggattggaag
cgtatgggtcttgaatatgttaaggccagacaattagcattgcgtagggcttatcctgaa
caattcaaacaattagtaggtgaggaattaagtgacttgaacatggagagtttgactggt
ggtaagaagttcaaaatcagtagaccactaagtgtaccgggttctccaaaagatgctaga
tctaacagtgcggtatacatgaccccaggtgacctgggaaccttacaagaagctaacaat
gtggatgactatttcaatctgagcgttagcggagatggtgacgacgatgacgaaaactat
gccgaacataattga

DBGET integrated database retrieval system