KEGG   Candida glabrata: CAGL0F08041gHelp
Entry
CAGL0F08041g      CDS       T01024                                 

Definition
(RefSeq) hypothetical protein
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cgr  Candida glabrata
Pathway
cgr00010  Glycolysis / Gluconeogenesis
cgr00030  Pentose phosphate pathway
cgr00051  Fructose and mannose metabolism
cgr00052  Galactose metabolism
cgr00680  Methane metabolism
cgr01100  Metabolic pathways
cgr01110  Biosynthesis of secondary metabolites
cgr01130  Biosynthesis of antibiotics
cgr01200  Carbon metabolism
cgr01230  Biosynthesis of amino acids
cgr03018  RNA degradation
Module
cgr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAGL0F08041g
   00030 Pentose phosphate pathway
    CAGL0F08041g
   00051 Fructose and mannose metabolism
    CAGL0F08041g
   00052 Galactose metabolism
    CAGL0F08041g
  Energy metabolism
   00680 Methane metabolism
    CAGL0F08041g
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CAGL0F08041g
Enzymes [BR:cgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CAGL0F08041g
Protein phosphatases and associated proteins [BR:cgr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CAGL0F08041g
Messenger RNA biogenesis [BR:cgr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CAGL0F08041g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-GeneID: 2887882
NCBI-ProteinID: XP_446318
UniProt: Q6FTX6
Position
F:complement(792575..795550)
Genome map
AA seq 991 aa AA seqDB search
MLHQDNCYGVAFRAIATADEELFKQTVRFYHSLGFSTIKDFNKFKHGENVVLASGTSDDS
LREVWLESFKLSETDSLGFRVPQQEASNKAQSQGAFVKVRLVMHEPLKDVYSTAQTSHIT
YFSADLPAIAKEFGDKVTKVSDSVLQMNDPMGNQLSFTSFASPLDEKPTNMDAFLKPLEK
EDDITASQSTDAVNQLKESLQSGSNLQKKKKIAVMTSGGDSPGMNAAVRAVVRTGIHYGC
DVFAVYEGYEGLLRGGKYLKKMHWEDVRGWLSEGGTLIGTARSMEFKKREGRKRAAGNLI
SQGIDALVVCGGDGSLTGADLFRSEWPSLVEELVKDGTFTSEQVAPYRNLTIVGLVGSID
NDMAGTDSTIGAFSALERICEMVDYIDATAKSHSRAFVVEVMGRHCGWLALMAGIATGAD
YIFIPERAVPHGQWQDELKEVCQRHRNKGRRNNTIIVAEGALDDQLNPVTAEDVKDVLVD
LGLDTKVTILGHVQRGGTAVAHDRWLATLQGVDAVKAVLEMTPETPSPLIGILENKIIRM
PLVESVKLTKSVATAIENKDFDKAISMRDTEFIELYENFLSTTVKDDGSEMLPVTERLNI
GIVHVGAPSAALNAATRAATLYCLSHGHKPYAIMNGFSGLIQTGEVQELSWIDVENWHNM
GGSEIGTNRSVAAEDMGTIAYYFQKNKLDGLIILGGFEGFKSLKQLRDSREQYPIFNIPM
VLLPCTISNNVPGTEYSLGVDTCLNALVNYTDDIKQSASATRRRVFVVEVQGGHSGYIAS
FTGLVTGAVSVYTPEDPISLKSIREDLSLLKENFRHDKGENRNGKLLVRNEQASSIYSTE
LIADIISESSKGRFGVRTAMPGHAQQGGAPSSKDRVIASRYAVKCIKFIEQWNKKNKATA
LDKDAKVLRFKFDKHGAKIPTVEHEDDSAAIICVNGSHISFKPIASLWENETNIELRKGH
EVHWTEFNEISNILSGRLRLRAEVEASNNRV
NT seq 2976 nt NT seq  +upstreamnt  +downstreamnt
atgctacatcaggataactgttatggtgtagctttcagggctatcgccactgctgatgaa
gagctatttaagcaaacagtgcgtttctatcacagtctgggtttctccaccatcaaggac
ttcaacaagttcaagcacggtgagaacgtcgttctagcgtctggtacttccgacgattcc
ttgagagaggtctggctggagtccttcaagctaagtgaaaccgactctctagggttccgt
gtcccacaacaggaggcctctaacaaggcccaaagccaaggtgccttcgtcaaagttcgt
ctggtcatgcacgaacctttgaaggacgtatacagcactgcacaaacctcccacatcact
tacttctccgctgaccttccagccatcgccaaggagttcggcgacaaggtcaccaaggtc
tccgactccgtcctgcagatgaacgacccaatgggcaaccaattgagcttcacctcattt
gcatctcctctagacgaaaagccaactaacatggacgctttcttgaagcctctagagaag
gaggacgacatcaccgctagccaaagcaccgacgccgtcaaccaactaaaggagtcccta
caaagtggctccaacctacaaaagaagaagaagatcgccgtcatgacttccggtggtgac
tctccaggtatgaacgccgccgttcgtgctgttgtccgtaccggtatccactacggttgc
gatgttttcgccgtttacgaaggttacgaaggtctattgagaggtggtaagtacttgaag
aagatgcactgggaagatgtcagaggctggctaagcgagggtggtactttgatcggtacc
gctcgttccatggaattcaagaagcgtgaaggtcgtaagagagctgccggtaacttgatt
tctcaaggtatcgacgctctggtcgtctgtggtggtgacggttctctaaccggtgccgac
cttttcagatccgaatggccatccttggttgaagaattagtcaaggacggtactttcacc
agcgaacaggtcgccccatacagaaacttgaccattgtcggtttggtcggttctatcgat
aacgatatggctggtactgactccaccatcggtgccttctccgctttagaaagaatctgt
gaaatggttgactacatcgatgccaccgccaagtctcactccagagccttcgttgtcgaa
gttatgggtagacattgtggttggttagctttgatggctggtatcgctaccggtgctgac
tacattttcatcccagaaagagctgttccacacggtcaatggcaagatgagttgaaggaa
gtctgtcaaagacacagaaacaagggtagaagaaacaacaccatcatcgttgctgaaggt
gctctcgatgaccaattgaacccagttactgccgaagacgttaaggatgtcttggttgat
ctaggtctagacaccaaggttactatccttggtcacgttcaaagaggtggtaccgctgtc
gctcacgacagatggttggccactttgcaaggtgttgacgctgtcaaggccgttctagaa
atgaccccagagaccccatctccattgattggtatcctagaaaacaagatcattagaatg
ccattggttgaatctgtcaagttgactaagtctgttgctacagcaattgaaaacaaggac
tttgacaaggctatttccatgagagacactgaattcatcgaactgtatgaaaactttttg
tctactactgttaaagatgatggttctgaaatgctgccagttactgaaagattaaacatc
ggtattgtccacgttggtgctccatccgcagctttgaacgctgccactcgtgctgccact
ctatactgtttgtctcacggtcacaagccatatgccatcatgaacggtttcagtggtcta
atccaaaccggtgaagtccaagagttgagctggatcgatgttgaaaactggcacaacatg
ggtggttccgaaattggtaccaacagatctgttgccgctgaagacatgggtaccatcgct
tactacttccaaaagaacaagcttgatggtttgatcattttgggtggtttcgaaggtttc
aagtctttgaagcaactacgtgacagcagagagcaatacccaatcttcaacatcccaatg
gttctattgccttgtaccatttctaacaacgtcccaggtactgaatactccttgggtgtt
gatacctgtttgaatgccctagttaactacactgatgacattaagcaatctgcctctgct
accagaagaagagtcttcgtcgttgaagttcaaggtggtcactccggttacattgcttct
ttcactggtttggttactggtgctgtctctgtatacactccagaagatccaatcagccta
aagtctatcagagaagatctttcattgttgaaggagaacttccgtcacgacaagggtgaa
aacagaaacggtaagttgttggttagaaacgaacaagcttccagcatttacagcactgag
ttgattgctgacatcatttctgaatccagcaagggtagatttggtgttagaactgctatg
ccaggtcatgctcaacaaggtggtgctccatcctctaaggatcgtgttatcgcctccaga
tatgctgttaagtgtattaagttcattgaacaatggaacaagaagaacaaggccactgct
ttggacaaggatgctaaggttttgagattcaagtttgacaagcacggtgctaagattcca
actgttgaacacgaagatgactctgctgccattatctgtgtcaacggttctcacatctcc
ttcaagccaatcgcttctctatgggaaaacgaaaccaacattgagctaagaaagggtcat
gaagtccactggaccgaattcaacgaaatcagtaacatcctttccggtagattgagattg
agagctgaagtcgaagcttctaacaacagagtttaa

DBGET integrated database retrieval system