KEGG   Candida glabrata: CAGL0G02717gHelp
Entry
CAGL0G02717g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
cgr  Candida glabrata
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CAGL0G02717g
Enzymes [BR:cgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     CAGL0G02717g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:complement(249013..250560)
Genome map
AA seq 515 aa AA seqDB search
MFLWIVGVLSLYVSLPFVKFLRSDAVSWHDRYVPRGNFTEWVHAQNSIALERLLDNFIDE
NGAILASPSRNEPDYYYQWVRDSAIVVNTLVKQLPAIEQNLQYDQLVHRRILQFLNNSFV
LQRLDNLSGKGVPTSIRGLGEPKFNVDNTQFNENWGRPQNDGPPLRIITILNYLQHLNNT
GKQIDHIITHNAKEGFLPFKVTKDIFDNILFWDLQFIVDEWKSENFDLWEEVRGHHFFTS
VMQLYAIERTLPIAKQNHLLRKKFVESLVDTRHKIREFILDNRTGFISKSANHIISCPEI
YGKRSGLDIATILASIYTHDGSNTSEHLDLFHVDNRYILNTLYGLTESMSDLYPINKENE
RHSKKHNLAAVALGRYPEDVYDGVGISEGNPWYLATAAAAEHMYKLARKFIEDEKSIPIS
PSDEFWKFIIETDSKDKFDVKYHSHAFNETIKSFVALGDSFLDKIRLHVADDGSMSEQIN
KYTGYNQGASDLTWSYGSYLNAYQAREEILAYLSH
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgtttctgtggattgttggagtgttgtcgctgtatgtgtcgttgccctttgtgaaattt
ctccgtagcgatgctgtctcttggcatgacaggtatgtgccaagaggtaatttcacagag
tgggtgcatgcacagaactccattgctctggagaggttgctggacaacttcatcgatgag
aacggtgccatactggcttcaccctctcgaaatgagcccgattactactaccagtgggta
agagacagtgctattgtggtcaatacattagttaaacagttgcctgcaattgaacagaac
ctgcaatatgatcaattggtgcataggaggatactccagttcttgaacaactcgtttgtg
ttgcaacgcttggataatctctccggtaaaggagttccaacttcaataagagggttgggt
gagcccaaattcaacgttgacaacacccagtttaacgaaaattggggcagaccccagaat
gatggcccacctttacgaataattaccatcttgaattacttacaacatttgaacaacaca
ggtaaacagattgatcacattattactcataatgccaaagagggtttcctacctttcaag
gtaacaaaagatatatttgacaatattctattttgggatttgcaattcatagtcgatgaa
tggaaaagtgaaaacttcgacctatgggaagaagttaggggacatcatttcttcacctct
gttatgcagctttatgcaattgagagaacattaccaatcgctaaacagaatcacttattg
agaaaaaaatttgtggaatctctggtggatactagacataagattcgtgaattcatatta
gacaataggacagggttcatttcaaaatctgctaaccacatcatatcatgcccggagatc
tatggcaagcgctcgggtttagatattgcgaccatattggctagtatttacacccatgat
ggtagtaatacatctgaacatctagacttatttcatgtggacaaccgctatatactgaat
acattatatggtctcaccgaatccatgtcagacttgtacccgataaacaaagagaacgag
aggcattcaaagaagcataatctagccgctgtggcactaggtagatatccggaggatgtg
tatgatggtgtcggaatatcagaaggtaacccatggtacttagccactgctgctgccgcc
gaacacatgtacaaacttgcaagaaaattcatagaagatgaaaaaagtattccaatttct
ccaagtgacgaattttggaaatttattatcgagacggatagtaaagataaatttgatgtg
aagtatcattcacacgcattcaatgaaacaatcaaatcatttgttgctttaggggactcg
tttctcgacaaaatcagattacatgtagccgacgatggatctatgagtgaacaaataaac
aagtacacagggtataaccaaggtgcctctgatctaacatggtcttatggttcttatttg
aatgcgtatcaagctagagaggaaattctagcttatttatcgcattga

DBGET integrated database retrieval system