KEGG   Candida glabrata: CAGL0G03399gHelp
Entry
CAGL0G03399g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
cgr  Candida glabrata
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CAGL0G03399g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:complement(325879..326988)
Genome map
AA seq 369 aa AA seqDB search
MSFFQRNSAAGNTTSTVMATEKDLQNEIVINNPADDSISDIAFSPQHDFLFSVSSWDGKV
RIWDAQNGVPQGKAQYEHNGPVLCTRWSLDGARIASGGCDNTVKLYDVASGQSQQIGSHN
DAVKSLRFVQCGPTNTECLVTGSWDKTIKFWDTRQPQPITTIAMPERVYTMDNKQQLLVV
GTAERHIAIINLANPTTIFKSSQSPLKWQTRVVACYNEGDGYAIGSVEGRCAIKYVDDEA
QKKSGFSFKCHRQTQPNRAAGSSSQSLVYPVNSIAFHPIYGTFVTAGGDGSFHFWDKNQR
HRLKGFPSMQGSIPVCNFNRNGSILAYAVSYDWHQGHMGNRPDYPNVIRLHPTTDEEVKE
KKKKTTFGR
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttttttcagagaaacagtgcagccggaaacacaaccagcactgtaatggcaact
gagaaggaccttcaaaatgaaattgtaataaacaaccctgctgatgattctatttcagat
attgcgttttcaccacaacatgattttcttttcagtgtcagttcctgggatgggaaagtg
cgtatatgggatgcccaaaatggggttcctcaaggtaaagcacaatatgagcataatggt
ccagtactgtgcacaagatggtccttagacggtgctagaattgcgtctggtggctgtgat
aatactgttaaattatatgatgtggcttcaggacagagccaacaaattggaagtcacaat
gatgctgtaaaatcactaagatttgttcaatgcggacctacaaatactgaatgtcttgtc
acaggatcatgggacaagacaattaaattttgggatacaagacagcctcaaccaataaca
acaatagcaatgccggaacgtgtttatactatggataataagcaacagctgttggttgtt
ggtacagctgagaggcacattgccattataaatttggccaatccaacaactatttttaag
agttcacaatctccactgaaatggcaaacacgtgtggtagcatgttataatgaaggtgat
ggttacgctattggttcagtagaaggaagatgtgcgattaaatatgttgatgatgaagca
cagaagaagagcggtttttcgttcaagtgccatagacaaacacaaccaaatcgagctgct
ggatcatcaagtcaatctctggtatatccagtcaatagtattgcattccatcctatatat
ggtacgttcgttaccgctggtggtgatggttctttccatttctgggataaaaatcaaaga
cacagattgaaaggctttccatctatgcaagggtctattccagtatgtaatttcaatagg
aatgggtctatacttgcatatgcagtaagttatgattggcatcaagggcatatgggtaat
aggccagactatccgaatgtgataagacttcaccctaccactgatgaagaagtcaaagaa
aagaaaaagaaaacaacgtttggtcgctaa

DBGET integrated database retrieval system