KEGG   Candida glabrata: CAGL0G05247gHelp
Entry
CAGL0G05247g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
cgr  Candida glabrata
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    CAGL0G05247g
Enzymes [BR:cgr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CAGL0G05247g
Peptidases [BR:cgr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CAGL0G05247g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:complement(491024..493867)
Genome map
AA seq 947 aa AA seqDB search
MQMVPSNVPDIDVHIGLPQLINKAQEAVEFIVQESRCDAVIMRTLKRTSSFSNGKKPKGT
DVTNNEMKYLLDQCLDHLSKLNECTKAIRKKSHGNLDIQYVHAYFYYKIVHILMTNVIPG
LAEFQSLKNTIKKKAGSIESELLQIYNVILSSLISDETIEIIHHSKAILKVNESNYNEKQ
VSEKHTPSDKSSLTENDQPQLCAHINSSQLDKLLRQNSNDLLIIDVRERESYNNVHIRAQ
NILCLEPIAFSENYTYRDLVKRSMITAPKDEILLLGNLSNFKYIILTTALSSDLLKSYSS
KLDCLKEILYQYLTMQPNGRFSRLLVHKDGIEAWCKDGYIVEHSDDHEKSIGDDSEESLM
DSTRESSGESNEVITTKDDSVYVSGDLRSLSLQELPELTPSVSNSMDSSMMAMMRPEAVT
QGYNNIYQNPTERKVSRSSSFKNFFNKKRTSSMSLGSHTRSVSTPMAPINDLYNDTKLNP
NSFNDRSLSGLSLDPPLKPMPISYPSNPVIKTTKTQAMSPGPAKSVSPSSLTFVGDDVSK
SPTGLRSSSNATIKEVLSSPTGRKFNHSVLPNTKKDYDLNFTVGLENMGNSCYMNCILQC
IMGTNELSQIFLNNSYEKHININSKLGSKGVLARYFARLAHIMHQTSYDQEKKAAIVRPT
QFRMAIASINSMFRNTNQQDCQEFCQFLLDGLHEDLNQCGNNPPLKELSEEAEKKRELLS
LRIASSIEWERFLTTNFSVIIDLFQGQYASRLKCSVCSNTSTTYQPFSVLSVPLPTGTKS
SVNLMDCFNEFTKCEKLEHDEYWNCPTCKKKQPSTKQLTITRLPRNLIIHLKRFDNRMNK
NTKLIDYPFNLDLTSFWANDKDDRLPPGVSIDELPARGQIPPFKYSLYAVANHFGSLYGG
HYTSYVNKGLSRGWYYFDDQNYRLVKKTSEVVNSNAYVLFYRRVHGI
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atgcagatggtgccaagcaatgtccccgacatagacgtgcacataggtctcccgcagttg
attaataaggcgcaagaggcggtagaatttatagtgcaagaaagtcggtgcgatgctgtt
attatgcgtactttgaaacgtactagctcttttagtaacggtaagaaaccaaaaggtaca
gatgtcacgaataatgaaatgaaatacttgcttgatcagtgcctagatcacttgtcaaaa
cttaatgaatgcacaaaagctatacggaaaaaaagtcatggaaatttggatatacaatat
gttcatgcttacttttactataagatagttcatatcttaatgactaacgttattcctggt
ttagctgagttccaaagcctaaagaatacgataaagaaaaaagcaggctcaattgaatcg
gaactcttacagatatataatgtcatattatcatcactgattagtgatgaaactattgaa
attattcatcattcaaaggctatactgaaggtcaatgaaagtaattataatgaaaaacaa
gtctcagagaagcatacaccttctgataaaagctctttaactgaaaatgatcagccccag
ctctgtgcacatatcaatagcagccaattggacaagcttttgcgacaaaatagcaatgat
ttactgataatagatgtcagagaaagggaaagttacaataatgtgcatattcgcgctcaa
aatatactctgtttggagcccattgcattcagtgagaattatacttatagagacttagta
aagagatcaatgataactgcaccaaaagatgaaatcttacttctcggaaatttgtcaaac
ttcaagtacattattcttacaactgctctctcaagcgatttgttgaagtcatactccagt
aaactggactgtctgaaagaaattttataccaatacctcacaatgcagccaaacggtcgt
tttagccgattgcttgttcataaggatgggattgaggcttggtgtaaagatggttatata
gtagaacatagtgatgaccatgagaaatccatcggagatgatagtgaagaaagcttgatg
gatagtacgagagagtcttcaggtgaatcaaatgaagttataactacaaaagacgacagt
gtttatgtatcaggtgatttaagaagtttaagtttgcaggagctccctgaacttactcct
agtgtcagtaactccatggattcaagtatgatggcaatgatgaggccagaagctgtaact
cagggctataacaatatctaccaaaatcctacagaacgtaaggttagtagaagttcaagc
ttcaaaaatttttttaataaaaagagaacatcttcaatgtccttagggtctcatacaagg
tctgtatcaacaccaatggctccaattaatgatttgtacaacgataccaaattaaatcca
aacagctttaatgaccgatcactatcaggtttatctcttgacccacctttaaagccaatg
cctatttcttatcccagtaaccctgttatcaaaacgacaaaaacgcaagctatgagtcct
ggtcctgccaaatctgtttcaccaagttctttaacatttgttggagatgatgtgtctaag
tcaccgacaggtctcagaagctctagcaatgcaacaatcaaagaagttttgtcaagtcct
actggcagaaaatttaatcattcagtgttacctaatacaaagaaggattatgacttgaac
tttaccgtgggtttggaaaatatgggcaattcgtgctatatgaattgtatcttgcaatgc
attatgggtacaaatgaactgtcacagatatttttaaataactcctacgagaagcacatt
aatattaacagtaaattaggttctaagggagtcttagcgagatattttgctagacttgca
catattatgcaccaaactagttatgatcaagaaaaaaaagctgctatagttagaccgaca
caatttagaatggcgatcgcttcaataaattctatgtttagaaatacaaatcaacaagac
tgtcaagagttctgtcaattcttattggatggattgcatgaggacttgaatcaatgcggt
aataaccccccattaaaagagctttctgaagaagctgagaagaagagggaattattatct
ttaagaattgcatcgtcaattgaatgggagagatttttgactacaaacttcagtgtaata
atcgatttattccaagggcaatatgcatcaagactaaagtgtagtgtctgttccaatact
tcgacgacataccagcccttttcagtcttatcagtcccgctcccaaccggtaccaagtct
tcggtaaatttaatggactgttttaatgaatttacaaaatgtgagaagctggaacatgat
gaatattggaactgtccgacatgtaaaaaaaagcagccttcaacaaagcaactaacaatt
actaggttaccccgtaacctcataatccatcttaaaaggttcgataataggatgaacaag
aatactaaattaattgattatccctttaacctggatttgacatcattttgggcgaacgat
aaagatgaccgactaccaccgggtgtaagtattgatgaattaccagcaagaggtcaaatc
cctcctttcaaatatagtctttatgccgttgcaaatcattttggaagtttgtatggtggg
cattatacttcttatgttaataagggactatcaagaggttggtattattttgatgatcaa
aattatagattagtaaagaaaacgtccgaggttgtaaattcaaatgcgtatgttttattt
tatcgtagggtgcatggtatatag

DBGET integrated database retrieval system