KEGG   Candida glabrata: CAGL0G09020gHelp
Entry
CAGL0G09020g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
cgr  Candida glabrata
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    CAGL0G09020g
Enzymes [BR:cgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     CAGL0G09020g
Protein kinases [BR:cgr01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   CAGL0G09020g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:860266..861351
Genome map
AA seq 361 aa AA seqDB search
MEYSSQHHSTHMQQQQHQQQHQHNTHGTSQQSTLLAQRSTVSKGKYSLQDFHIMRTLGTG
SFGRVHLVRSVHNGRYYAIKVLKKAQVVKMKQIEHTNDERRMLKLVEHPFLIRMWGTFQD
SRNLFMVMDYIEGGELFTLLRKSQRFPNPVAKFYAAEVTLALEYLHFHNIIYRDLKPENI
LLDRNGHIKITDFGFAKEVETVTWTLCGTPDYIAPEVIATKPYNKSVDWWSLGVLIYEML
AGYTPFYDTTPMKTYEKILHGKVVYPQFFNSDVIDLLSKLLTADLTRRIGNLQKGAQDIK
SHPWFAEVVWEKLLAKDIETPYEPPITAGVGDTSLFDQYPEEQLDYGVQGSDPYASYFTD
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggagtattcttcacaacaccattctacacacatgcagcaacaacaacaccaacaacag
caccagcacaacacacacgggacttctcaacagtctacgttgctggcgcaacgttcgact
gtctcgaaggggaagtactcgttacaggactttcatataatgcggacactaggtactggg
tcattcggcagagtacacctggtgagatcggttcacaacggcagatattatgctatcaaa
gtattgaaaaaggcacaggtggttaagatgaagcaaattgagcacaccaacgatgagaga
cggatgctaaaacttgtggagcaccccttcttgattagaatgtggggcactttccaggac
tcacggaacctgttcatggtgatggactacatcgaaggtggtgagttgttcacattgcta
agaaaatcacagaggttccctaatcctgtggccaaattttacgccgctgaggttacgcta
gcattagagtacttacatttccacaatattatctacagagatttaaagccagaaaatatc
ctgttagacaggaacggacacatcaagattacagacttcggcttcgcaaaagaagtggaa
acagttacatggaccttatgtggtacccccgattacatcgcaccagaagttatcgcaaca
aaaccatataacaaatcagtcgactggtggtcattgggtgtcctgatttatgaaatgttg
gccggatataccccattctatgatactaccccaatgaaaacttatgaaaagattctacat
ggtaaagttgtgtatccacaattcttcaactcagatgtcatcgatttgctaagcaaatta
ctgactgctgacttaactaggagaatcggtaacttgcaaaagggagcacaagatatcaaa
tcacacccctggtttgctgaagttgtctgggaaaaattattggctaaagatatcgagaca
ccatatgaacctcctattactgctggtgttggtgatacttctctttttgaccagtatcca
gaagagcaattagattacggagtacagggatcagacccttacgcaagctactttactgat
ttctag

DBGET integrated database retrieval system