KEGG   Candida glabrata: CAGL0G09383gHelp
Entry
CAGL0G09383g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K00134  
glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
cgr  Candida glabrata
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:cgr01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cgr01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cgr00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:896159..897157
Genome map
AA seq 332 aa AA seqDB search
MVRIAINGFGRIGRLVLRVALSRSNIEVVAVNDPFITTDYAAYMFKYDSTHGRYAGEVTH
DDKHIIIDGKKIAVHQERDPANLPWGSENIDIAIDSTGVFKELDTAQKHIDAGAKKVVIT
APSSTAPMFVVGVNEDKYTSDLKIVSNASCTTNCLAPLAKVIDEAFGIEEGLMTTVHSLT
ATQKTVDGPSHKDWRGGRTASGNIIPSSTGAAKAVGKVLPQLQGKLTGMAFRVPTVDVSV
VDLTVKLQKETTYDEIKKVIKQASEGKLKGVLGYTEDAVVSSDFLGDSRSSIFDASAGIQ
LSPKFVKLVSWYDNEYGYSTRVVDLVEHVAKN
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggttagaattgctattaacggtttcggtagaatcggtagattggtcttgagagtcgct
ttgtccagatccaacattgaagttgttgctgtcaacgatcctttcatcaccactgactac
gctgcttacatgttcaagtacgactctacccacggtagatacgctggtgaagttacccac
gatgacaagcacatcatcatcgatggtaagaagatcgctgtccaccaagaaagagaccca
gctaacttgccatggggttctgaaaacatcgacattgctatcgactccactggtgtcttc
aaggaattggacactgctcaaaagcacatcgacgctggtgccaagaaggttgtcatcact
gctccatcttccaccgccccaatgttcgttgttggtgttaacgaagacaagtacacttct
gacttgaagattgtctccaacgcttcctgtaccactaactgtttggctccattggccaag
gttattgacgaagctttcggtatcgaagaaggtttgatgaccactgtccactccttgacc
gctacccaaaagaccgtcgacggtccatcccacaaggactggagaggtggtagaaccgct
tccggtaacatcatcccatcctccaccggtgccgctaaggctgtcggtaaggtcttgcct
caattgcaaggtaagttgaccggtatggctttcagagtcccaaccgtcgatgtctccgtt
gtcgacttgaccgtcaagttgcaaaaggaaaccacctacgatgaaatcaagaaggtcatc
aagcaagcttccgaaggtaagttgaagggtgtcttgggttacactgaagacgctgttgtc
tcctctgacttcttgggtgactccagatcttccatcttcgacgcttccgccggtatccaa
ttgtctccaaagttcgtcaagttggtctcctggtacgacaacgaatacggttactccacc
agagttgtcgacttggttgaacacgttgccaagaactaa

DBGET integrated database retrieval system