KEGG   Candida glabrata: CAGL0G09383gHelp
Entry
CAGL0G09383g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K00134  
glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
cgr  Candida glabrata
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CAGL0G09383g
   01230 Biosynthesis of amino acids
    CAGL0G09383g
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAGL0G09383g
Enzymes [BR:cgr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     CAGL0G09383g
Exosome [BR:cgr04147]
 Exosomal proteins
  Proteins found in most exosomes
   CAGL0G09383g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:896159..897157
Genome map
AA seq 332 aa AA seqDB search
MVRIAINGFGRIGRLVLRVALSRSNIEVVAVNDPFITTDYAAYMFKYDSTHGRYAGEVTH
DDKHIIIDGKKIAVHQERDPANLPWGSENIDIAIDSTGVFKELDTAQKHIDAGAKKVVIT
APSSTAPMFVVGVNEDKYTSDLKIVSNASCTTNCLAPLAKVIDEAFGIEEGLMTTVHSLT
ATQKTVDGPSHKDWRGGRTASGNIIPSSTGAAKAVGKVLPQLQGKLTGMAFRVPTVDVSV
VDLTVKLQKETTYDEIKKVIKQASEGKLKGVLGYTEDAVVSSDFLGDSRSSIFDASAGIQ
LSPKFVKLVSWYDNEYGYSTRVVDLVEHVAKN
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggttagaattgctattaacggtttcggtagaatcggtagattggtcttgagagtcgct
ttgtccagatccaacattgaagttgttgctgtcaacgatcctttcatcaccactgactac
gctgcttacatgttcaagtacgactctacccacggtagatacgctggtgaagttacccac
gatgacaagcacatcatcatcgatggtaagaagatcgctgtccaccaagaaagagaccca
gctaacttgccatggggttctgaaaacatcgacattgctatcgactccactggtgtcttc
aaggaattggacactgctcaaaagcacatcgacgctggtgccaagaaggttgtcatcact
gctccatcttccaccgccccaatgttcgttgttggtgttaacgaagacaagtacacttct
gacttgaagattgtctccaacgcttcctgtaccactaactgtttggctccattggccaag
gttattgacgaagctttcggtatcgaagaaggtttgatgaccactgtccactccttgacc
gctacccaaaagaccgtcgacggtccatcccacaaggactggagaggtggtagaaccgct
tccggtaacatcatcccatcctccaccggtgccgctaaggctgtcggtaaggtcttgcct
caattgcaaggtaagttgaccggtatggctttcagagtcccaaccgtcgatgtctccgtt
gtcgacttgaccgtcaagttgcaaaaggaaaccacctacgatgaaatcaagaaggtcatc
aagcaagcttccgaaggtaagttgaagggtgtcttgggttacactgaagacgctgttgtc
tcctctgacttcttgggtgactccagatcttccatcttcgacgcttccgccggtatccaa
ttgtctccaaagttcgtcaagttggtctcctggtacgacaacgaatacggttactccacc
agagttgtcgacttggttgaacacgttgccaagaactaa

DBGET integrated database retrieval system