KEGG   Candida glabrata: CAGL0G09977gHelp
Entry
CAGL0G09977g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
cgr  Candida glabrata
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cgr00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:951295..955881
Genome map
AA seq 1528 aa AA seqDB search
MSAHRTLLLRLSDSGEPVTSCSYGQGVLTLPSLPLPQGKKLGDMPVYTVKLAIPAGSPVT
RDGLIWTNCPPDFSTQFDREKFYKKIIKTSFHEDDHIDLDIYVPGTYCFYLSFKNDKDEL
ETTRKFYFVVLPILSVNDKFIPLNSIAMQSVVSKWMGPTIKDWEKVFARVASKKYNMIHF
TPLQHRGESNSPYSIYDQLEFDPTVFKSEKEVADMVERLRTEHNILSLTDIVFNHTANNS
QWLLDHPEAGYNHKTSPHLISAIELDKKLLDFSEQMEALGYPVDLKTVDDLIKVMDGIKE
HVIGELKLWEFYVVDVKQTVSELREKWGNSKSWSDDNIPSKDDSTNLAQFVRDNATEPGF
GSLGERGSNKINIDKFAAILKKLHSEDYNNGIEELATKILNDINLPFYKEYDDDINEVLE
QLFNRIKYLRIDDHGPKQGPITKKLPLSEPYFTRFKAKDGEEYALANNGWIWDGNPLVDF
ASSQSKAYLRREVIVWGDCVKLRYGKGPSDSPYLWERMSKYVEMNARIFNGFRIDNCHST
PLHVGQYFLDVARRVNPNLYVVAELFSGSEAMDCLFVERLGISSLIREAMQAWSEEELSR
LVHRHGGRPIGSYKFVPLDDFPYPADVKIDEEYCAYNPDDHSVKCVSEIMIPKTLTATPP
HALFMDCTHDNETPNQKRTVEDTLPNAALVAFCSSAIGSVYGYDEVFPQLLDLVQEKRTY
SCAENTGISKVKTLLNNMREEIASEAVDIEDSEMHVHHDGQYITFHRTNAKNGKGWYLVA
RTKFHSSGDQMLPRIKLSQTKATFKAAFSLERTGDAPISDEIIEGIPTKLRELTGFDIGF
DENTKETSILLPQDFPQGSIVIFETQQLGIDDSLDHFIRSGAIKATEKLSLESINYVLYR
AEQEEYDYSEGRSGAYDIPDYGKPVYCGLQGWVSILRKIIFYNDLAHPLSNNLRNGHWAV
DYVVNRLDLYKDKEGVAEVQEWLRSRMERIKQLPSYLVPSFFALVVGIMYGCCRLRAMQL
MSDNVGKSTVFVQSLAMTSIQMVSAMKSTSILPDQNIAAMAAGLPHFSTNYMRCWGRDVF
ISLRGLLLTTGRYEEAKEHILAFAKTLKHGLIPNLLDAGRNPRYNARDAAWFFVQAIQDY
VTIVPGGVSLLQEKVTRRFPLDDEYIPYDDPKAFSYSSTIEEIIYEILNRHAGGIKYREA
NAGPNLDRVMKDEGFNVEVNVDWETGLIHGGSQFNCGTWMDKMGESEKANSVGVPGTPRD
GAAVEINGLLKSCLRFVLQLSKDGKFKYTEVTKPDGSKISLSSWNDLLQENFERCFYVPK
NKEDDNKFEIDATIINRRGIYKDLYRSGKPYEDYQFRPNFTIAMVVAPELFTPDYAAGAI
ELADQVLRGPVGMRTLDPSDYNYRPYYNNGEDSDDFATSKGRNYHQGPEWVWCYGYFIRA
YHYFNFLTNPKCQVEGSAKKLKPSSYLYRKLYSRLLKHREWIENSPWAGLAELTNKDGEV
CNDSSPTQAWSTGCLLDLFYDLWISYEE
NT seq 4587 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcacacaggactttactgttgcggttgtctgatagcggtgagccagtcaccagt
tgttcttacggacaaggtgtgttgacgctgccatcgctgccactgccacaaggtaagaag
ctcggtgatatgccggtgtacaccgtgaaactggctattccagcgggctcgccagtgacc
cgtgacggtcttatctggaccaattgtccaccggacttctcgacccagttcgatagagag
aagttctacaagaagatcatcaagaccagcttccacgaggacgaccatatcgacctcgac
atctacgtgcctggtacttactgcttttacttgtccttcaagaacgacaaagacgagctg
gaaaccacaaggaagttctacttcgtagtgctcccaatcttgtccgtgaacgataaattc
atcccattgaactcaattgcaatgcagagtgtcgtctccaaatggatgggacctactata
aaggactgggaaaaagtattcgcaagagtcgcaagcaagaaatacaacatgatacatttt
accccattgcaacatagaggtgagtcaaactcaccatattccatatacgaccaattagaa
ttcgaccccacagtattcaaaagcgaaaaagaagttgccgatatggtggaacgtctgaga
actgaacacaacattctgtcgttgactgatatagtcttcaaccataccgcgaacaactct
cagtggcttctagatcacccagaagctggttacaaccacaagacttcacctcatctaatc
agcgctatcgaactagacaagaaattgctagattttagcgaacaaatggaggccttaggc
tatccagttgatctgaagactgttgacgacttaataaaagtaatggatggtatcaaagaa
catgtgattggagaattgaaattgtgggaattctatgtagtcgacgtgaaacaaactgtt
tctgaactccgtgaaaaatggggcaattcgaagtcatggtctgatgacaatattcctagc
aaggatgattccacaaacttagctcaattcgtaagagataacgctactgagccaggtttt
ggatcgctgggtgaaagaggttcaaacaaaattaacatagataaatttgcagctatttta
aaaaagttacactctgaagattacaataatggtatcgaagagttggccactaagatcctt
aatgacatcaatttgccattttacaaagagtacgacgacgatataaatgaagtgttggaa
caattattcaacagaatcaagtatttgagaattgatgaccatggcccaaaacaaggccca
attacgaaaaagttgccattatcagaaccatatttcactagattcaaagctaaagatggt
gaagaatatgccttagcaaacaacggttggatatgggatggtaacccgctagttgacttt
gcctcgtctcaatcaaaggcttacttaagaagagaagttattgtgtggggtgattgtgta
aagttaagatatggtaaaggtccatctgattctccatatctatgggaaagaatgagtaag
tatgttgaaatgaacgcaagaatttttaatggtttcagaatcgataattgtcactccaca
cctttacatgttggacagtatttcctagatgttgctagaagggtaaaccctaacttatac
gtggttgcagagttattctccggctccgaggcaatggattgcttgtttgtcgaacgttta
ggtatttcatcgctaatcagagaagcaatgcaagcttggtcagaagaagaattatctcgt
ctagtacacaggcatggtggtagaccaattggatcttacaaatttgttccattagatgat
ttcccatatccagctgatgtgaaaatagacgaagagtattgtgcctacaacccggatgat
cactctgttaaatgtgtgtcagaaattatgataccaaagactctaacggcaactccacct
cacgcgctctttatggattgcactcatgacaatgaaacaccaaatcaaaaaaggaccgtg
gaggacacacttccaaatgctgccttggttgcattctgttcttctgccattggctctgta
tatggatacgatgaagtgttcccacagttgctagatttggttcaggaaaagagaacatat
tcttgcgctgaaaacactggtattagtaaagttaaaactttgttgaacaatatgagggaa
gagattgcatcagaggccgtagatatcgaagactcggaaatgcatgttcatcacgatggt
caatacattacattccatcgtactaatgccaaaaatggtaagggttggtatttagtggct
agaaccaaattccattcgtctggagaccaaatgttgccaagaatcaagttaagtcaaact
aaggctactttcaaagctgcattttcactggaaagaacaggggatgcaccaatatcagac
gaaataattgagggtattccaaccaagttaagggaattgactggatttgacattggtttc
gatgagaacaccaaagaaaccagtattctattgccccaagatttcccccagggctcaatt
gtcatatttgaaacccagcaacttggtattgatgactccttagaccactttatcagatct
ggggctatcaaggctacggaaaagctttccttggaatccatcaattacgttttgtatcgt
gctgaacaagaggaatatgactacagtgaaggaaggtctggtgcttatgacattcctgat
tatggtaaacctgtttattgtggtttacaaggttgggtaagcatattacgtaaaattatc
ttttacaatgatctagctcatcctttgagtaacaacttgcgtaacggccattgggctgta
gattacgtcgtcaacagattggatttatacaaagacaaggaaggtgttgctgaagttcaa
gaatggttgagaagtagaatggaaaggatcaagcaattgccaagctatcttgttccaagt
ttcttcgctctagttgttggtattatgtatggatgttgcaggttacgtgctatgcagtta
atgtcagataatgttggcaaatctactgtctttgttcaaagtttagccatgacttcgata
caaatggtatctgctatgaagtctacttcaattctccctgatcagaatatagccgctatg
gctgcaggtcttccacatttcagtaccaattacatgagatgctggggtagagatgtgttc
atttctttgagaggacttttattaactacaggtcgatatgaagaagcgaaggagcacatt
ttagcatttgctaagactttgaagcatggtttgattcctaatcttcttgatgctggcaga
aatcctagatataatgcacgtgatgcagcatggttctttgttcaggctatccaagattat
gttactatagtcccaggaggggtatcacttcttcaagaaaaagtcactagaagattccca
cttgatgatgaatatataccatatgatgatccaaaagcatttagttattcgagtacaatc
gaagaaataatctatgaaatattgaatagacatgctggcggcattaaatacagagaagcc
aatgccggtcctaatttggatagggttatgaaagatgaaggcttcaatgtcgaagttaat
gtagattgggaaactgggctaattcatggtggttcccaatttaactgtggtacttggatg
gacaaaatgggtgaaagtgaaaaggctaactcggtcggggttccaggtacaccaagagat
ggagctgccgttgaaattaatggattgttgaagagttgtttgagatttgttttgcaatta
agcaaagatggcaaattcaagtatactgaggttactaaacctgatggttctaaaatatca
ctttcttcttggaatgatttactgcaggagaactttgaaagatgtttctatgttcctaag
aataaggaggacgataataagtttgaaattgatgcaactattataaacagaagaggtata
tataaggatttgtaccgctctggaaaaccatatgaagattaccaattcagaccaaacttt
acaatcgctatggttgtcgcacctgaattatttactcctgactatgcagctggtgctatt
gagcttgcagatcaagttttgagaggcccagttggtatgcgtactttggacccaagtgat
tacaactacagaccatattataataatggtgaagatagtgatgactttgctacttctaag
ggtagaaattaccaccaaggtcctgaatgggtttggtgttatgggtacttcatcagagca
tatcattatttcaactttttgactaatcccaaatgccaggtagaaggcagtgctaaaaag
ctaaagccttcatcatacctgtacagaaaattgtactcgcgtctgctgaagcatagagaa
tggattgaaaacagcccttgggctggtcttgctgagttaacaaacaaagacggtgaagtt
tgtaatgactcaagtccaacacaagcgtggagtacgggctgtctactggatctattttat
gacctctggatttcctatgaggaatga

DBGET integrated database retrieval system