KEGG   Candida glabrata: CAGL0H01441gHelp
Entry
CAGL0H01441g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cgr  Candida glabrata
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cgr01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cgr00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
H:complement(140740..142023)
Genome map
AA seq 427 aa AA seqDB search
MTETRVGGKPFTIVIKLGTSSLVDEKTKEPRLAIMSLIVETVVKLRRLGHNVVIVSSGSI
GVGLHILGMEKRPKHLSEVQAIAAIGQSKLIGRWDSLFAHFGQSIAQILLTRNDILDWSQ
YRNAQNTVEELLKMGVVPIINENDTLSVQEIKFGDNDTLSAITAGLIHADYLFLLTDVDC
LYTADPRSDPDAKPILIVPDLSKGLPGVDTSSGSGSDVGTGGMQTKLVAAELATNAGVHT
IIMKSDAPSNIYKIVKYIQSLHDTGEDNKVFEGDLMKLQLEEYEKLDRMGVPFHTKFLAN
SISRHLRNKEFWILHGLVTSGAVIIDEGAYKALTRKNKAGLLPVGVIEIEGSFHEMECVD
LKVGKRLPNGELDPDYPLTIVGRARCNYPSLEISKIKGQQSDEIENELGYCNSEYIAHRE
NMAFPPH
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaactagagttggtggtaagccatttacaattgtgatcaagcttggtacgtct
tctttggttgatgagaagaccaaagaaccaaggctagctatcatgtccttgattgtggaa
actgttgtcaaattacgtaggttaggccataatgttgtaatcgtttctagtggtagtata
ggtgttgggctgcacattttgggtatggagaagaggcctaaacatctgtcagaagtccaa
gcaattgcggccattggtcaaagcaaactgattggtagatgggactccttgtttgctcat
tttgggcaatctattgctcaaattcttctaacgagaaatgacattctagactggtctcaa
taccgaaacgctcaaaatactgtggaagagcttttaaagatgggtgtagttccaattatc
aatgaaaatgatacattatctgttcaagagattaagtttggtgataacgatactctttca
gctattacagcagggttgatacatgctgattatttattcctattaactgacgtggactgc
ttgtacaccgctgatccaagaagtgatcctgatgctaaaccaattttaattgttccagac
ctgtccaaaggtctaccaggtgttgatacatcatcgggttctgggtctgacgttggtacg
ggtggtatgcagacaaagttagtcgctgctgagcttgcaaccaacgctggtgttcataca
atcataatgaaaagtgatgctccttccaatatttacaagattgtgaaatatatacaatca
ttgcatgacactggtgaagataacaaagtatttgaaggtgatttaatgaaacttcagctt
gaagagtatgaaaagcttgacagaatgggcgttccctttcacactaagtttttggccaat
agtatatcgcgccacttaagaaataaagaattttggattttgcatggtttagttacttct
ggggcagtgattattgatgaaggtgcctacaaggctttgacaagaaagaacaaagccggt
ttgttacccgtcggtgtcattgaaattgaaggatccttccatgaaatggagtgtgttgac
ttaaaggttggtaaacgtttgccaaatggagaattggatcctgattacccactaacaatt
gttggaagggccagatgtaattatccatcattagaaattagcaaaatcaaagggcaacaa
agtgatgagatcgagaacgaattaggttactgcaactccgaatatatcgctcatagagag
aatatggcattcccaccacattaa

DBGET integrated database retrieval system