KEGG   Candida glabrata: CAGL0H07359gHelp
Entry
CAGL0H07359g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cgr  Candida glabrata
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CAGL0H07359g
Enzymes [BR:cgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CAGL0H07359g
Exosome [BR:cgr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CAGL0H07359g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
H:complement(718943..720580)
Genome map
AA seq 545 aa AA seqDB search
MIRNTERESLLTSQNKRHKKYFKYGLKYILTTVLVFFTFLHIWYPDVISESLHWNSHAKK
KNVIFFVTDGMGPASLSLTRSYRQYVQGLDIDDILELDRHLIGSSRTRSYNSLVTDSSAG
ATAFSCGMKTYNSGTGVGPDKTPCGTLLEAAKLKGYLTGLVVTTRLTDATPAAFSSHVDY
RFQEDQIAEQQLGNYPLGRMVDLMMGGGRTHFYPSGTNDPRYGRRGLRQDDRNLIEEAIE
NGWQYAGNRNDFDDLKMGKNVTLPLLGLFADFDIPFEIDRSDKEYPSLEEQTITALTALN
DASKHSDKGFFIMIEGSRIDHAGHQNDPAAQVREVMAFDKAFKAALEFAKESDTETVIIS
TSDHETGGLVTARQVTVSYPEYVWYPEVLFNSKHSGEYLKHKIANYKGNDKKRFIEKEVF
EKIMNIGDYSDSDVEDLSNMTNVEDIQYKLNDMISFRAQIGWSTHGHSAVDVNIYAYSNR
PKSWQYLLSKLQGNHENIEIGHFMRDYLELDLEEVTKRIKDTDHSPRKQGNIYIDEYHPA
STVGI
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgatcagaaatactgagcgggagtcattactgacatctcaaaataagcgtcataaaaaa
tatttcaagtatggattgaagtacattctcacaacagttttagtttttttcacatttctg
catatatggtacccggatgttatatctgagagtcttcactggaattcccatgcaaagaag
aagaatgtcatcttctttgtgaccgatggtatgggaccagcctcactgtcactgactagg
tcgtacagacagtatgtacaaggattagatatcgacgacatcttagagttggatagacac
ttaattggctcttcaagaacaagatcgtacaattctttagttacagattcttctgcagga
gcaacagcattttcgtgtggtatgaagacctataatagtggtacaggtgttggaccggac
aagacaccatgtggtactttgttagaagcagcaaagctcaaaggatacctaactggattg
gtagttacaactaggttaactgatgctacaccagctgcatttagttcgcatgtggactac
aggtttcaagaagatcagatcgccgaacaacaactaggtaactacccactaggacgaatg
gtagatcttatgatgggtggtggcagaacacatttttatccctccggtactaatgatcca
aggtatggtcgtagaggtttacgtcaagatgacagaaacttaatcgaagaggctattgaa
aacggatggcaatatgctggtaacagaaatgatttcgatgacctaaaaatgggtaagaat
gtcacactgccattgttaggtttatttgctgattttgatatcccatttgaaattgataga
tctgataaagagtatccatcacttgaagagcaaacgatcacggctctaactgccttaaat
gatgcctcaaagcactcggataaaggattttttatcatgatagagggctcaagaattgac
catgcaggacatcaaaatgatcctgcagcacaggttcgtgaagtgatggcatttgacaag
gcattcaaagcggctttagagtttgccaaagaatctgatacagaaactgtcataatatcg
acatcagatcatgaaactggaggtctggtgactgccagacaggtaacggtctcttatccg
gaatatgtgtggtatccggaagtattattcaatagcaagcactctggtgaatatttgaag
cacaagattgctaattacaaaggcaacgacaaaaagcgtttcattgagaaggaggtgttt
gaaaagataatgaatattggtgactattctgatagtgacgttgaagacttgagcaatatg
acaaatgtggaagatattcaatataagttgaatgatatgatttcgtttagagcacaaatt
ggatggtctacgcatggccatagtgcagtagatgtaaacatatatgcatactctaacagg
cctaaatcgtggcagtatctgctaagtaagttgcaaggaaatcatgaaaatattgagata
ggtcatttcatgagggattacctggaattggatcttgaggaagttacaaagcgtatcaag
gataccgatcattctccaagaaagcaaggtaatatctatattgacgaatatcaccctgcc
agtactgttggaatataa

DBGET integrated database retrieval system