KEGG   Candida glabrata: CAGL0H09504gHelp
Entry
CAGL0H09504g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cgr  Candida glabrata
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cgr00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
H:complement(929241..930857)
Genome map
AA seq 538 aa AA seqDB search
MLSPLTALPKNAKVAVGGSGIAGLSFAYFLAKMRPDVSVTLYEKAARNSGWINSWQTKDK
NGQPVMIERGPRTLRGVSDGTVMMIDAMKDLKSLDIVHFIEHNSDADKKFLLDPNDKLVK
VPDSFLSGIKFIMSDLGKGIIPAMLGEFWRKASANPGKDETVASMLDKRMGNEHLGKNVF
SAIYRGIYADDINTLSAKKVMHKMVANELKFGSNTKALIHSMKTKKDRKKNADSLTLILD
KYTKVMGKEESKILELSKKLKHYPMLGFKGGLESFCQTLLKGLESMPNVSVLNNSAITKL
ISDAKSDNNNITVEINHGKSTEKFDHVRLTGIPHRLGPLLREIDGHIADSLETIKANTVV
LVNFYLPDKDVIPKKNRGFGYLVPESNPNKEKLLGVIFDSVIEQNLKNIENAQEMVSSDK
KSYTKLTAMVGGYMYNDPATGEPVVPKDEQIIDAVRNTLERHLGVSPNDLDRGLWQVTPA
NKCLPKYNVGYMDWQTDMEKKILKLFNNKVSIGGMGFAIGPGIPDVFADGFQDALKLR
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgctttctcccttgacagctcttcctaagaatgccaaagtggctgtaggtggtagcggt
atagctggtctatcatttgcatacttcttagccaaaatgaggccagatgtatctgttaca
ttgtatgaaaaggcagcaagaaatagtggatggatcaattcatggcagacaaaggacaag
aatggtcaaccagtaatgatagaacgtggaccaagaaccttaagaggtgtatcagatggg
acagtaatgatgatcgatgccatgaaagacctgaaaagcttggacatagtacattttata
gaacacaactctgatgctgataagaagtttttacttgatccaaatgacaaactagttaag
gtacctgactcctttttgagtggtattaaattcataatgagtgatttagggaaaggtatt
atacctgcaatgctaggtgaattctggagaaaagccagtgcaaaccccggtaaggatgaa
actgtggcttccatgttagataaaagaatgggtaatgagcatttaggtaaaaatgtcttc
agtgccatatatagaggtatctatgctgacgatattaatactctcagtgccaaaaaagtt
atgcacaagatggtagcaaatgaactgaagtttggctctaacacaaaagcattaattcat
tcgatgaagactaaaaaagacaggaaaaagaatgctgactctttaaccttgattctcgat
aaatatactaaagtaatgggaaaggaagagtctaagatattagagctgtctaagaagtta
aagcattaccccatgttaggttttaagggaggcctagaaagcttctgccaaacattactc
aaaggtcttgaatccatgcctaatgtctccgttttgaataactcagctatcactaaatta
atctcagacgcaaagtctgacaataataacataactgttgaaattaatcacggaaagtcc
acagagaaatttgaccacgttcgcctaaccggtattccccatagattgggaccattacta
cgtgagattgatggccatatagccgacagtctggagaccatcaaagccaataccgtggtt
ttggtaaatttctacctgcctgataaggatgtcatcccaaagaaaaaccgtggttttggc
tatctggtacctgagtcaaacccaaataaagaaaaactattgggtgtgatctttgactca
gttattgagcaaaacttgaaaaacattgagaatgcacaagaaatggtatcatcagacaaa
aaatcttatactaagttaacagctatggttggtggatatatgtataacgatcctgctacc
ggtgaacctgtagtaccaaaagatgagcagattatcgatgctgttagaaacactttagag
agacatttgggagtatcacctaatgatcttgacagaggtttgtggcaggtaactcctgca
aacaagtgtttgccaaaatataatgttggctacatggattggcaaaccgatatggaaaag
aaaatactaaaactcttcaacaacaaggtttctataggtggtatgggctttgccattggt
cctggtatccctgatgtttttgcagatggattccaagatgcgttaaaactacgttaa

DBGET integrated database retrieval system