KEGG   Candida glabrata: CAGL0I00264gHelp
Entry
CAGL0I00264g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cgr  Candida glabrata
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CAGL0I00264g
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CAGL0I00264g
Enzymes [BR:cgr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CAGL0I00264g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(18821..19306)
Genome map
AA seq 161 aa AA seqDB search
MSPFHQLRPVDGQGNIYPFEMLKGKVVLIVNTASNCGFTPQYIELENMYQKYKNEGFEIL
GFPCNQFGHQEPGSDAEIQKFCSSKYKVTFPIMKKIDVNGPYEDPVFKYIKEQKPGMLGL
KGIKWNFEKFLIDRQGNVVLRASSLTKPSTLNETIEKLLKN
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccatttcaccaattgcgcccagttgatggccaagggaatatctatccttttgag
atgttaaaaggtaaggttgtcctcattgtaaacacagcctcaaactgtggttttacacct
caatatatcgaattagaaaacatgtatcagaaatataagaacgagggtttcgaaatatta
ggtttcccctgtaatcaatttggtcatcaagagccgggcagcgatgccgaaattcagaaa
ttttgttcctctaagtacaaggttactttcccaataatgaagaagattgacgtcaatggt
ccatatgaagaccctgtcttcaagtatatcaaagaacaaaagccaggaatgctaggtctg
aagggtataaagtggaattttgagaagtttctaatagatcgacaaggtaatgttgtttta
agagcttcatcattaactaagccatcaactttgaatgaaacaatagaaaagcttttaaag
aactga

DBGET integrated database retrieval system