KEGG   Candida glabrata: CAGL0I00418gHelp
Entry
CAGL0I00418g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cgr  Candida glabrata
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CAGL0I00418g
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CAGL0I00418g
Enzymes [BR:cgr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     CAGL0I00418g
Lipid biosynthesis proteins [BR:cgr01004]
 Desaturase
  First
   CAGL0I00418g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:30058..31530
Genome map
AA seq 490 aa AA seqDB search
MSRVETRNVTTEFQKDGLDEVDLVQANILAAGLDKKTVRVVNGLGKLMGSKEMVQVEFNK
DKPTSKISASTPHISEQPWTLNNWHEHLNWLNLVLVCGLPMIGWYFVVSGKAKLTWQMAL
FATFYYALGGISITAGYHRLWSHRAYSARLPLKIFFAFFGAASVQGSIKWWGHSHRIHHR
YTDTLRDPYDARQGLWYSHMGWMLLKPNPKYKARADISDLTDDWVVRFQHKHYIPMMLLS
GFVLPCLLGGYLLNDYLGGLIYGGFIRIFVIQQATFCINSMAHYLGTQPFDDRRTPRDNW
ITAIVTFGEGYHNFHHEFPSDYRNAIKWYQYDPTKVFIYLTSLFGLSYDLKTFSQNIIQQ
ALIQQRQKKIDRDSKSVNWGPKLADLPAWTKEEFLEKNRENDGLVIVGGIVHDVSGYITE
HPGGEKLLKNALGKDATKAFSGGVYRHSNAAHNTLATMRVAVMKDNKETAMRFAQKRGER
AERVERAHMN
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgtctagggttgaaaccagaaacgttactacagagttccaaaaggatggcctcgatgag
gtcgacctagtgcaggccaacatcttagcggcaggcttagataagaagactgtgcgtgtg
gtcaatggtctaggtaagttaatgggttccaaagaaatggtccaagttgaattcaacaag
gacaagccaacttccaagatctctgctagtacaccacatatctccgagcaaccatggacg
cttaacaactggcacgaacatttaaactggttgaaccttgtgctagtgtgcggtctccca
atgattggttggtacttcgtagtatcgggtaaggcaaaattgacatggcaaatggctttg
ttcgctactttctattatgctctaggtggtatttccatcaccgctggttaccatagattg
tggtcccatagggcttacagtgcacgcctaccactaaagattttcttcgctttctttggt
gctgcctctgttcaaggttctatcaaatggtggggtcattctcacagaattcatcataga
tacacagacactttaagagatccatatgatgctagacaaggtctatggtacagtcacatg
ggatggatgttgttgaaaccaaacccaaagtacaaggctcgtgctgatatttctgatttg
actgacgactgggtcgtcagattccagcacaaacactacatcccaatgatgcttttgtcc
ggtttcgtgctaccttgtttactcggtggttacttgctaaacgactacctaggtggttta
atctatggtggtttcatccgtatcttcgttattcaacaagccaccttctgtatcaactca
atggctcactacttgggtactcagccattcgatgacagaagaactcctagagataactgg
attaccgctattgtcactttcggtgaaggataccacaatttccaccacgaattcccatct
gactacagaaatgctatcaagtggtaccaatatgatccaaccaaagtttttatttacttg
acttctttgtttggtttgtcttatgacttgaaaactttctcacaaaacattattcaacaa
gccttgattcagcaaagacaaaagaagattgaccgtgatagtaagagtgtcaattggggt
ccaaaactggctgacttgccagcctggaccaaggaggaattcctagagaagaacagagaa
aacgatggtttggtcattgttggtggtattgtccatgatgtctcgggatacattactgag
cacccaggtggtgaaaagcttctaaagaatgctttaggtaaggatgccacaaaagctttc
agtggtggtgtataccgtcactctaatgctgctcacaacacattagctactatgagagta
gcagtgatgaaggacaataaagagactgcaatgcgttttgcccaaaagagaggtgaacgt
gctgagcgtgtcgagagagcacacatgaactga

DBGET integrated database retrieval system