KEGG   Candida glabrata: CAGL0I01078gHelp
Entry
CAGL0I01078g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
cgr  Candida glabrata
Brite
Exosome [BR:cgr04147]
 Exosomal proteins
  Proteins found in most exosomes
   CAGL0I01078g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:join(90566..90578,91000..91367)
Genome map
AA seq 126 aa AA seqDB search
MSWQAYTDNLLATGKVDKAVIYSKAGDAVWATSGGLSLQANEISEIVQGFDNPTGLQSNG
LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLIAHYPPTVQAGEATKIVEQLADY
LISVQY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcaagcttacactgataacctactagctactggtaaggtcgacaaggccgtt
atttactctaaggccggtgacgccgtatgggccacttccggtggcttgtctctacaggca
aacgaaatcagtgagatcgttcaaggtttcgacaacccaaccggtttgcaaagcaacggt
ctacacatccaaggtcagaagtttatgctccttagagccgacgacagaagtatctacggt
agacacgacgcagaaggtgtggtttgtgtcagaactaagcaaactgttctgatcgcacat
taccctccaactgttcaagcaggtgaagccaccaagatcgttgaacaattagcggattac
ttgatcagcgtccaatactaa

DBGET integrated database retrieval system