KEGG   Candida glabrata: CAGL0I01408gHelp
Entry
CAGL0I01408g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
cgr  Candida glabrata
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CAGL0I01408g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(114899..115213)
Genome map
AA seq 104 aa AA seqDB search
MSEKKGATLFKTRCLQCHTVEKGGPNKVGPNLHGIFGRKSGQAAGYSYTDANIKKNVTWD
EDNMSDYLTNPKKYIPGTKMAFGGLKKEKDRKDLIAYLKKATSD
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaagaaaggtgctactttattcaagaccagatgtctacaatgccacaccgtt
gaaaagggcggtccaaacaaggttggtccaaacctacacggtatcttcggtagaaagtca
ggccaagccgctggctactcctacaccgacgccaacatcaagaagaacgtcacttgggat
gaggacaacatgtccgattacttgactaaccctaagaagtacatcccaggtaccaagatg
gctttcggtggtctaaagaaagagaaggacagaaaggacttgatcgcctacttgaagaag
gccacttccgattga

DBGET integrated database retrieval system