KEGG   Candida glabrata: CAGL0I01408gHelp
Entry
CAGL0I01408g      CDS       T01024                                 

Definition
(RefSeq) hypothetical protein
  KO
K08738  cytochrome c
Organism
cgr  Candida glabrata
Pathway
cgr01100  Metabolic pathways
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 2888955
NCBI-ProteinID: XP_447316
UniProt: P25400
Position
I:complement(114899..115213)
Genome map
AA seq 104 aa AA seqDB search
MSEKKGATLFKTRCLQCHTVEKGGPNKVGPNLHGIFGRKSGQAAGYSYTDANIKKNVTWD
EDNMSDYLTNPKKYIPGTKMAFGGLKKEKDRKDLIAYLKKATSD
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaagaaaggtgctactttattcaagaccagatgtctacaatgccacaccgtt
gaaaagggcggtccaaacaaggttggtccaaacctacacggtatcttcggtagaaagtca
ggccaagccgctggctactcctacaccgacgccaacatcaagaagaacgtcacttgggat
gaggacaacatgtccgattacttgactaaccctaagaagtacatcccaggtaccaagatg
gctttcggtggtctaaagaaagagaaggacagaaaggacttgatcgcctacttgaagaag
gccacttccgattga

DBGET integrated database retrieval system