KEGG   Candida glabrata: CAGL0I03498gHelp
Entry
CAGL0I03498g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K11226  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
cgr  Candida glabrata
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:cgr04011]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:297344..298699
Genome map
AA seq 451 aa AA seqDB search
MFKVKTLERRNLKQLSLGGGCLGGSAHAGSEELRHECNGNKLIVEDMALAVGSDEHIEPH
SGSGSASASSMSGLSIHDHAGDAAKPATLAVDGHSGCNYDLRDLVQLGKLGSGNSGTVMK
VLHVPSSRVIAKKTIVIEQNNAIVKQQIYRELTIMRSVAEHRNIVEFYGAHNLSSDSING
SNDVVILMEYMNCGSLDTITRTYKSLQRRGILAANRSYPVQEWFSKPVIISRIAYSVLNG
LSYLYENYKIIHRDIKPSNVLINSKGRIKLCDFGVSRKLNNSIADTFVGTSTYMSPERIQ
GNKYTTKGDVWSLGLMLIELLTGEFPLGGHNDTPDGILDLLQRIVNEPAPKLPSSVIKVL
PPDMVNFIDLCCVKVEKDRGSLQELLKHPFIVRFRTKESTDAFKLWTKDIRRWMQEERNY
KKETSEHSMLLKKQHNTNDTRHSRHMTSSLK
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaagtcaagactctagagcggagaaatttgaaacagctgtcgctgggcggtggc
tgtttgggtgggagcgcacacgcgggcagcgaggagctccgacatgagtgcaacggcaac
aagctgatagtggaggacatggcgctggccgtggggtccgacgagcacatagagccgcac
agcgggagcggcagtgcgagcgcaagcagcatgtcgggactgtcgatacatgaccacgcg
ggcgacgcggccaagccggcgactctggcggtcgacggccactcaggttgcaattacgac
ctgcgcgacctggtgcaactcgggaagctcgggtccggtaactcaggaacagtgatgaag
gtgctgcacgtaccgagctcgcgggttatcgccaagaagaccatagttatagaacagaac
aacgcaattgtgaaacagcagatataccgggaactgacgatcatgcgcagcgtcgccgag
catcggaacatcgtggaattctacggcgctcataacttgagctccgacagcatcaacggc
agcaacgacgtggtcatcctgatggaatatatgaactgcggctctctggacacaattaca
aggacttataaatcgctgcagagaagaggcatacttgctgccaataggagctacccagtg
caggaatggttctccaaacctgtcataatctccagaatagcatactcggtcctgaatggg
ttgagctatctatatgaaaactataaaataatccatagggacatcaaaccttcaaatgta
ttgataaacagtaaaggtcggatcaaactttgcgactttggtgtatctcgtaagctgaac
aactcaatcgccgacacttttgttgggacatcgacttacatgtcaccagaacgtatccag
ggcaataaatacacaaccaagggagatgtgtggtcactagggctaatgctgattgaacta
ctaacgggagagttcccattgggcggacataacgatactccagacggtattctcgatcta
ttacaaagaattgttaacgaaccagctcctaaactaccatcttcggttatcaaagtatta
ccaccagatatggtaaattttatcgatttatgctgtgtgaaagtggaaaaggatagaggc
tccttacaagaactactgaaacacccttttatcgtgaggttccgcactaaagaatcgact
gatgctttcaaactgtggaccaaggatatcaggcgctggatgcaagaagaaagaaactat
aaaaaggaaacgagtgaacattcaatgttgctgaaaaaacaacataacactaacgatacc
cgccattcaagacacatgacgtcaagtttgaaatga

DBGET integrated database retrieval system