KEGG   Candida glabrata: CAGL0I06765gHelp
Entry
CAGL0I06765g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
cgr  Candida glabrata
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:cgr04144]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:655806..658469
Genome map
AA seq 887 aa AA seqDB search
MPGIEQPVSRKNETLVKLSSLADEFVFNDEVQLNLQDVLQECVDTYQNYQDEVKKIKNMD
HTESEKVSELCKSAYIYYKIVHNFITKVIPHLPEFEVATGPKASKLQAELIKIYYSLFSR
LESDKKISYIKNIIIKHMDTQENNHSVESHEQVKLSNKKLPVNRDAIEIDKDSILQDIRY
INGKRSGSGISCSELLSLMKMKEDSLLLIDVRPKLEYDAHHIKTKNIICIEPISFKESYS
DQQIEKTSMIPSPKHEIQLFQRRSEFQYIILYTDLEEKSNFYFQQLKSLLEILLQRSFLR
PIDDRKTKVLFLSDSLQNWIKNGGEIDKSQEVSKIRNRSISGSGPLLNSLSERKTIGAFP
DINRNSTKQMPISPLPSLPGSERTVATPPNGSSTLGRINSPVTHYPKAPLINDSEFHLNI
NNNHSPPTHLPSKDNNPLASSMPIGSDHKPFMSPQNSLPLAPKPPTLESKNYNFISDRSN
IIDQKQNRSRSLEPQLPPIPSTLIRKNSPEKTLSCNQMMDTSFTVGLENMGNSCYINCII
QCIFATTELIKIFLNGTYAKHINKQSKLGSKGVLSHNFAKLLKDMYEENSSKKIGKKHGA
VKTLQFKMACASVNSLFKDASQQDCLEFCQFLLDGLHEDLNQCGANPPLKELSPEAEKMR
ENLSLRVASSIEWERYLTTDFSIIVDLFQGQYASQLRCKVCNRTSTTYQAFSVLSVPVPS
GKSCGLLDCFIEFTKTENLEVDEQWFCPSCKKKQPSTKKLTITRLPRNLIIHLKRFDNMM
NKNNIFVRYPQILDLTPFWANDSDGKLPPGITDEIPARGQVPPFNYRLYGAACHFGTLYG
GHYTSYVDKGPEKGWIYFDDTVYRPVRFQNEFISPSAYVLFYHRITS
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atgcctggtattgaacaaccggttagccggaagaacgaaacactggtaaaattatcaagc
ttagccgacgagtttgtgtttaatgatgaagtccagttgaacttacaggatgtactacaa
gaatgcgttgacacgtatcagaactaccaggatgaagttaaaaagattaaaaatatggat
cacactgaaagtgagaaagtatcagaactctgcaagtcagcatatatctactacaagata
gtccacaacttcataacgaaagtaataccccatctacctgaattcgaggtggcaactgga
cctaaagcatcgaagttgcaagctgaactgatcaagatatactattcattattctctcga
ttggagagtgacaagaaaataagttatattaaaaacataattataaagcatatggatact
caagaaaataatcattcagttgaatcacatgaacaagtcaaattgagtaacaaaaaacta
ccagttaatcgtgatgccatagaaatcgataaggattccatacttcaggatatcaggtat
attaatggtaagagatccgggtcaggtatatcatgttcagagctattgtctttgatgaag
atgaaggaagatagcttactattaatagatgtgcgaccaaaacttgaatacgatgcccac
catatcaagactaaaaatatcatatgtatagaaccgatatcattcaaagaaagctattca
gatcaacagatagagaagacttcaatgattccttctccgaagcatgagatccaattattt
caacggagaagcgaatttcaatatatcatcttatatacagacctggaagagaagtctaat
ttttacttccaacagttaaaatcactattggagatacttttacagcggtcttttctgaga
ccaatcgacgatagaaagaccaaggttctttttttaagcgattccctacaaaattggata
aagaatggaggggaaatcgataaatcacaggaggtaagcaaaattagaaataggtcaatc
agtggcagcgggcctctactaaattcattatcagaaagaaaaacaatcggagcctttcca
gatatcaatcgaaatagtacaaagcaaatgccaatatccccattaccatctttacctgga
tcagaaaggacagttgctacaccaccaaacgggtcaagtacccttggcagaataaatagt
ccagttacccattatcccaaagccccactaattaacgatagtgaattccacttgaacata
aacaacaatcactcacctcccactcacctcccctccaaggacaacaatcccctggcaagt
agtatgcctattggttcagatcataaaccatttatgtctccacaaaattccttgccacta
gcacccaaacccccgacattagaatcaaaaaactataacttcatatctgatcgttctaac
ataattgaccaaaaacaaaatagaagtaggtcacttgaaccccagctgccacctatacca
agcactctgataagaaaaaattcaccagaaaaaactttgtcatgtaatcaaatgatggat
acatcctttactgtgggtttggaaaacatgggaaattcatgttacataaattgcataata
caatgtatttttgcaactacagaacttatcaaaatttttcttaatggaacctatgccaaa
catattaacaagcagagtaaactcggctctaagggggttctaagtcataattttgcaaag
ctattaaaagatatgtatgaagagaatagtagcaaaaaaattggtaaaaagcatggtgca
gttaaaactctccaattcaagatggcctgtgcatctgtaaattccttatttaaagatgct
agccaacaagactgtctggaattttgtcaattcttattagatggactccacgaggatttg
aaccaatgtggggctaatccacccctcaaggaactttcaccggaagctgagaaaatgagg
gagaatttatctttgcgtgtggcatcaagcattgaatgggaaaggtatttaacaactgac
ttcagcataattgtagacttatttcaaggccagtatgcatcccaactaaggtgtaaagtt
tgcaatcgaacttcaacgacatatcaagccttttccgtgttatctgtgcctgtaccctca
ggtaaaagttgtggtttattggattgcttcatcgaatttactaagactgaaaacttggaa
gtagatgaacaatggttctgtccaagctgtaaaaaaaagcaaccatcaaccaaaaaattg
actatcacccgtctacccagaaatctgataattcatttgaaaaggtttgacaacatgatg
aataaaaataacatatttgttagatatccccaaattttagatctaacaccattttgggca
aacgactctgatggaaagttaccacctggtatcactgatgaaataccagccagaggacaa
gtacccccatttaactacagattatatggtgctgcatgccatttcgggactttgtacggg
ggacattacacatcatatgttgacaaaggtcccgaaaaaggttggatttattttgacgac
acagtatacagacctgtaagattccaaaatgaatttataagccctagtgcctatgttttg
ttttatcatcgcataacgtcttag

DBGET integrated database retrieval system