KEGG   Candida glabrata: CAGL0J00385gHelp
Entry
CAGL0J00385g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cgr  Candida glabrata
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CAGL0J00385g
   00670 One carbon pool by folate
    CAGL0J00385g
Enzymes [BR:cgr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CAGL0J00385g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
J:29762..30487
Genome map
AA seq 241 aa AA seqDB search
MTASAAPRLLFLHGFLQNGKVFSEKSSGIRKLLKKADIQCDYIDAPVMLEKKDLPFEMDD
EKWAATLEADVNRAWFYHSEISKELDLTEAINTVANHIKENGPYDGIVGFSQGAALSTII
TNKISELVPSHPEFKVSLVISGYSFTEPDPENPGQLRITEKYRESFKPNPESQTKMLFVY
GASDMAVPSERSKYLYNLYKESFGEDAEGTKLHAFEHPGGHMVPNKKDIIRPIVEQITSS
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctagcgctgctccaagactattattcctacacgggtttttgcaaaatggtaaa
gtattctcagagaagtcttccggtatcagaaagttgttgaagaaggctgacatacagtgc
gattatatcgatgctccagttatgcttgagaagaaagatttgccatttgaaatggatgat
gaaaaatgggctgcaactctagaggcagatgtcaacagagcttggttctatcacagtgaa
atctccaaagaactggacttgactgaagctattaacaccgttgctaatcatataaaggaa
aatgggccatacgatggtattgttggattttctcaaggtgctgctctatctactatcatc
actaacaagatctctgaactggtacctagtcatccagaattcaaagtcagtttagtcatt
tctggttattcatttactgaaccagatccagaaaatccaggtcaattgagaatcacagaa
aagtacagagaatcattcaagccaaaccctgaatcacaaactaaaatgctatttgtatat
ggtgcctccgatatggctgtgccttctgagagatccaagtatctatacaacttgtacaag
gaatcttttggagaagatgcggaaggtacaaaattgcatgcatttgaacatccaggtggc
catatggttccaaacaaaaaggacattatcagaccaattgttgaacaaattacatcatct
ttatag

DBGET integrated database retrieval system