KEGG   Candida glabrata: CAGL0J00539gHelp
Entry
CAGL0J00539g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
cgr  Candida glabrata
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    CAGL0J00539g
Enzymes [BR:cgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CAGL0J00539g
Protein kinases [BR:cgr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CAGL0J00539g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
J:47095..48561
Genome map
AA seq 488 aa AA seqDB search
MDVERQTFKVFNQDFTIDKRFELIKEIGHGAYGIVCSARFTEASEETTVAIKKVTNIFSK
TLLCKRSLRELKLLRHFRGHKNITCLYDMDIVFYPDGSINGLYLYEELMECDMHQIIKSG
QALTDAHYQSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENP
EENNQFLTEYVATRWYRAPEIMLSYQGYTKAIDIWSTGCILAEFLGGKPLFKGKDYVDQL
NRILQVLGTPPDETLRRVGSKNVQDYIHQLGYIQKIPFSELFPNANEDALDLLEGMLAFD
PQKRITVDKALEHPYLTIWHDPADEPECNEKFEFSFESVNEMEDLKRMVVDEVQSFREFV
RQPLMDDKSQEDEQQQGSPENYQQTSPTNISPQRLHNNGSHDLLQEPEFLTQTPNQNSTI
PDQLQESFVGIHSDNLPEHDTDFPPRPQENILASPMGLPSASDRNSMNNDSFLDLERELE
FGLDRRYL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggacgttgagagacagacatttaaggtctttaaccaggacttcaccattgataagagg
ttcgaattgatcaaagagattggccatggcgcatatggtatagtgtgttctgccaggttc
acagaggcaagcgaggagactacagttgctatcaagaaagtgaccaacatcttcagcaaa
acacttctgtgtaaaagatcgctcagagagttgaagcttctgagacattttagaggacat
aagaacattacctgtctttacgatatggatatcgtattctacccagatgggtctataaat
ggcctttatttatacgaagaactgatggaatgtgatatgcaccagattataaaatctggg
caagcactaacagatgcgcattaccagagtttcacatatcagatcttgtgtggtttaaaa
tatatccactcagctgacgttctacatcgtgacttaaaaccaggtaatttgctggtgaat
gccgattgccaacttaaaatttgtgatttcgggcttgcaagaggttatagtgagaatccc
gaagagaacaaccaatttttaactgagtatgtggcgaccaggtggtatagagcacctgaa
atcatgctaagttaccaaggttacacaaaggccattgacatctggtcaacaggttgtatt
ttagcagagtttttaggtggcaaaccgttattcaaggggaaggactacgttgatcaactg
aatagaattttacaggtcttaggtacaccacctgatgaaactttaaggagagtgggctca
aagaatgtccaagattatattcaccaacttggatacatacaaaagataccattttctgaa
ttattccctaatgcgaatgaagatgctttagatctcctggagggaatgctggcgtttgat
ccacaaaagagaataactgtggataaggcactagagcatccatatctaaccatatggcac
gacccagctgatgaacctgagtgtaacgaaaagtttgaattcagtttcgaaagcgtgaac
gaaatggaagatttaaagcgcatggttgttgatgaggtacaaagtttcagggaatttgta
aggcaacctttaatggatgacaaatctcaagaagacgaacaacaacaaggatctcccgag
aattaccaacagacaagcccaacgaatatatccccacaacgtttacataataatgggtct
catgatctgttacaggaaccagaatttttgacacagacaccaaatcagaactcaactatt
ccggatcaactacaggaatcattcgttggaatccactcagataatttacctgagcatgat
acagatttcccaccgagacctcaagagaacattctggcatcacctatgggactcccatcc
gcatctgatcgaaactccatgaacaacgattccttcctcgatttagaacgcgagttggag
tttggactggataggagatatttatga

DBGET integrated database retrieval system