KEGG   Candida glabrata: CAGL0J00759gHelp
Entry
CAGL0J00759g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
cgr  Candida glabrata
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CAGL0J00759g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
J:74694..79826
Genome map
AA seq 1710 aa AA seqDB search
MKWSVSQFSDLYASIDAKAISSELFTQLLPDLKELLKYPPKNTESRNKLEKLQDYKTDDG
SIFKLNQDFIISIISLSDELNLDELEAVNLVLENSPGSQIYASEVVNNGKISFFLRRQYI
LQIVSYICNAEDVMSPYYKKFFNAETNTTILSKVLENFDIISKHLSDIKQEVNRNQILDN
MNPLITQGIHFKRDFFSKEYDLLSQVLYGLSKRSLINTQISSVDLIIEHSLKMETNDFFV
VYFLPTLLNLFSNLNTFSDVDIFGLHKKYTNELITKQEQVYKKPMKVLIMFIFLTFLIGW
CKEDPQNRVTKLNFKSDIDDPMTIAVELGAIEQLLIVIADLSRIDESTAVQYYDFRALLE
RHLPRFIPLQLVDENVIQKYNQMSSLTERSDSTKINGPHESFSRNTYRPPSMISPNNYSK
DNRFTNGLGSTSISMDRLNEGRVFFSTSDMNKEISKFRENISEMFEMFLEENIHHFIQTF
ISDCAFLLTKLKDAEEDSLLSGEDLDLDDIATKADLERFFVSVFYFYSKRPHYVAAFWED
KESAAYGFVEWASKCNDNLMKSCFYLMLGGLSSGKENALNVYYYLGDSNPTSWKRIADTI
GSYSSKILNLGKAIQAKEQENEGELNTTLLALEEGLNEETIVFLSSLLTLISSVADQMEP
DEKLMFSHLFVDVIFELTKCETPLVGACFNTISTLVPILESDRASIWHKLDSTLFKGVAL
SDTSQYISAFSSILTTYSDVLGFLALIRNLLQIESFDCNKEFLVFGHLQYPNQLGRPYRK
SGIWPYLEFVMNEVFVNSDKITDSFKRHELQERVLEIILTCLNSFDYSVLLNSISVGANL
DNLVHGENFASYVQDNAAPAMFNFLFQENVYTKLYSIASVGIDNSSLLKPHSQLQTLLRL
SLSVIERTLDYEKTYTEELLTIIKKYQSGEFYRPKYYGLHGLVSFTQTVFFNLDFVTCLG
LYIGLDNDSIPIISINILRKLALLFNSTEPDPILGNKLFTLFDSIDESARIKDAFIDQLD
CPIENSDNLMLKVEILEFLKDSLDIESSKPSVAHLLLGFQYDNTLTFGPNLSTFIQSGHS
LFHSVIRLLISALNELSSYKIDFAPMRLAALSLQLLELMCKSQLTSDLVIEHITNNEIIK
KIMDVDPQTSNHTLWNGLNLESTTQSTKARFIQGSSAGAYLMFLRYRTSMIQFLNVVIHT
ISLKGTISRVAPYTSYLISNSIYSARIFSLLRPLHQNIILKEKIVPENLQLLKDLPVDLD
KVQLRKSCTGNIYDFDEISSVLELHSKTYSVSQLNSKEFMDKILSEFEEVKQLITLFLVR
KESFSQQLAILHNWVQLVQIIVSDGNLGERKRSTFILEVFDMVTPKISVYVDIDVKFAEE
LVSLMVFLFHIYNQSNASSSGKYFLDSKLHNLFQVCIRGISSPLSSLKLRSDFYVIANNY
LLRVLKNSGMAYAIVKDLRLNNERLVEVICNDAIYGEGAIKITGLLLLDSLVQLGNHHQE
NFIVMTLMRSTKLFHIIRSLKATDSLLNASTENVNVENFLYELTAFKATAYFLIRIAETR
EGAVALIESKVFDILAELNFLKIDPDLGLELVFDETSNNTSSLLRVNITFDEPLILGKEA
TSVSIFELIIPIFQLMLAIVISSGRFNDAVRLATTSLLKQYQKLIIGTFKRDTLYKSGKK
QASDELKYKHHQEFIKLVVLICTITKYEDK
NT seq 5133 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggagcgtatcacaatttagtgatctttatgcttccattgatgctaaggcaatt
agctccgagctattcactcaattattgcctgatctgaaagaacttctcaaatatccacca
aagaacaccgaatcacggaacaaactagaaaaactacaagattacaagaccgatgatggg
tcaatcttcaaattgaaccaggatttcattatatctataatctcattatctgatgaactt
aacttagatgaattagaggcagtgaatttggtattagaaaattcccctgggagtcaaata
tatgcttctgaagtagttaataatggtaaaatatcctttttcctcagaaggcaatacata
cttcagattgtgtcttatatctgcaatgctgaagatgttatgagtccttattataaaaag
ttctttaatgcagaaaccaataccactattttaagcaaagtcctggagaattttgatata
atatcgaaacacttgtcagatatcaagcaggaagtgaatagaaatcaaatccttgataac
atgaatccattgattactcaaggcattcattttaaaagggattttttctctaaagaatat
gatttacttagtcaagtgctatatggattgtcaaaaagatcattaataaatacacagatc
agttccgttgatttgattattgaacattcattaaaaatggaaactaatgacttcttcgtg
gtgtattttcttccaacgttattaaacttattttctaatcttaacacattctctgatgtg
gatatattcggactgcacaagaagtatactaatgagttgataacaaaacaagagcaagtt
tataaaaaaccaatgaaggtattaattatgtttatttttctaacatttttgattggatgg
tgtaaagaagacccccaaaatagagtaacaaaactgaatttcaaatccgatattgatgac
cccatgactatcgcagttgaattaggtgcaattgaacaactactgattgtaatagctgat
ttatctcggatagatgaatcaacagctgtacaatattatgattttagggcacttttggaa
agacacctaccaagatttatcccattacagttagtggatgaaaatgttatacagaagtat
aatcaaatgtctagcttgactgaacgttctgacagcacaaagataaatggacctcatgaa
agctttagcaggaatacctaccgtcctccttcaatgatttcacctaacaactatagcaaa
gacaacaggttcacaaatgggttaggatcaacctcgattagtatggatagattaaatgag
ggaagggtttttttctctacttcagatatgaataaagaaatttcaaagtttcgtgaaaat
atttccgaaatgtttgagatgtttctagaagaaaatatccatcatttcatccaaacattt
atttcagattgtgcatttttgctaacaaaattaaaagacgctgaagaggactcgttattg
tccggtgaagatcttgatttggatgatatagcaaccaaagcagatttagaaagattcttt
gtgtcagtattttacttctattccaagagaccacattacgtagctgctttttgggaagac
aaggaatctgcagcatatggctttgttgaatgggcttcaaaatgtaatgataatttgatg
aagtcctgcttctatttaatgctaggtgggttatcatctggtaaagagaatgctttgaat
gtctattactaccttggtgactccaatcccacctcttggaaaagaatagctgatactatc
ggtagctattcctctaaaatactaaacttagggaaagctattcaagcaaaggaacaagaa
aatgagggtgagctcaacacaacgctacttgctttagaagaaggtttgaatgaagaaaca
atagtatttttgtcctcattgctcactttgataagttctgtagcggatcaaatggagcct
gatgagaagctaatgttctctcatttatttgttgatgttatctttgagttaacaaaatgt
gaaactcctctggtaggtgcctgctttaatacgatcagtacactggtcccaattttagaa
agcgacagagctagcatttggcataagctggatagcactttattcaagggcgttgccttg
tctgacacatcgcagtatatttctgccttcagttcgattttgactacatactctgatgtc
cttggatttcttgcattgattagaaatttactacagattgaatcttttgattgtaacaag
gagtttctagtatttggacatctacaatatccaaatcagttaggtcgtccatacagaaag
tcgggaatttggccttacttagaatttgtaatgaatgaggtatttgtcaactcagacaaa
attacagattcatttaaaagacatgaattacaggaacgtgtgcttgaaataattctgacc
tgtttgaattcatttgactattctgtgctattaaactctatttctgttggtgctaattta
gacaaccttgttcatggtgagaattttgcaagttatgttcaggataatgcagcacctgcg
atgttcaattttttgtttcaggaaaatgtatatacaaaactatactccattgcatcagta
gggatagataattcctcccttttaaaaccacacagtcagctgcaaactcttttgcgtctt
tctttatctgttatagagagaacattggattacgaaaagacttatacagaagaattgctc
acaataatcaaaaaatatcaaagcggtgaattttataggccaaaatactacggtcttcac
ggtcttgtatctttcacgcaaacagttttcttcaatttggattttgtcacttgtctaggg
ttatatattggcctggacaatgacagtattcctataatctcgattaatatcttacgaaaa
ttggcactattatttaattcaacagagcctgatccaatattgggtaacaagttatttaca
ctttttgattctattgatgagtcagcaagaatcaaagatgcttttattgatcaacttgat
tgtcctatcgaaaattcagacaatttaatgctgaaagtggagattcttgaatttctaaaa
gacagtttggatatcgaatcgtcaaaacctagtgttgcacatttattattgggctttcaa
tatgataatacgctaacttttgggcccaatttaagtacttttattcagtctgggcattca
ctctttcattcggtaattagacttttgatttctgctttgaatgaactgtccagttataaa
attgattttgcaccaatgcgattagcagcattatcgctgcaattattagagctcatgtgt
aaaagtcagttgacatcggatctggtaattgaacatatcacaaataatgaaataataaag
aagattatggatgttgatccccaaacgtcaaatcacactttgtggaatggcctaaatttg
gaatctactactcaatcaaccaaggcacgctttattcaaggtagctcggctggtgcatat
ctaatgtttttgagatacaggacatcaatgattcagttcctaaacgttgttattcatact
atctcattgaagggtaccatttcaagagtagcaccgtatacaagttatctgatatccaac
tctatctactctgctcgaattttttctctgttgcgtcccctacatcaaaatataatctta
aaggaaaagatagtgccagaaaaccttcagcttctaaaggatttgccagttgatttggat
aaagtccagctaagaaaaagttgcacaggaaatatctatgattttgatgaaattagctca
gtacttgaattacatagtaagacttattctgtgtctcagctaaactcaaaggaatttatg
gataagatactatccgagtttgaagaggtaaagcaacttattactctatttctagtaaga
aaggagtcattttctcaacagctggctattcttcataactgggtccaacttgttcaaatc
attgtatctgacggaaatttgggtgagaggaaaagatctacatttattctggaggttttt
gatatggttactccaaaaataagtgtttatgttgatatcgatgttaagtttgcagaagaa
ctggtttctctaatggtattcctattccatatatataatcaatcgaatgcaagctcatct
ggaaagtattttctggactctaaactgcacaatttattccaagtatgcataagagggata
agttctccattgtcatccttgaaactgagatcagatttttacgttattgctaacaattac
ctactgcgggttttgaaaaactctggtatggcttatgcgatagtgaaggatttacgccta
aataatgagaggctggtagaagtgatttgtaacgacgctatttatggagaaggagcaatt
aagataacggggttgttactcctggattcgttagtacaacttggaaatcatcatcaggag
aatttcatagttatgactttaatgagaagtacaaaattatttcacatcattcgttctttg
aaagcgacagattcactactaaatgcaagcacagaaaatgtcaatgttgagaatttcctg
tatgagctcactgctttcaaggcaacagcatatttcttgataagaattgcagaaacaaga
gaaggtgctgtagcactgattgaaagcaaagtttttgatattttagctgagctaaatttc
ttgaagattgatccggacctaggacttgagttagtatttgacgaaacttctaataatact
tcctctttattgagagtaaacattacatttgatgaacctctaattttgggtaaagaagcg
acttcggtctcaatttttgaattgataattccaattttccagctgatgcttgccattgtt
atcagttcagggagatttaatgatgctgtaagattagcaaccacttccttgttgaagcag
tatcaaaaattgatcataggtacttttaagagagatacgctttataaatctggaaagaag
caagcctcggatgaattgaaatataaacatcaccaagaatttatcaagcttgttgtttta
atctgcaccatcaccaaatatgaagataaataa

DBGET integrated database retrieval system