KEGG   Candida glabrata: CAGL0J01441gHelp
Entry
CAGL0J01441g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cgr  Candida glabrata
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:cgr01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cgr00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:cgr00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:cgr00350]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
J:complement(134383..135501)
Genome map
AA seq 372 aa AA seqDB search
MFTRVAAAARIQSRRPLRLRLQSTLSIPQSQKGVIFYEHGGKLEYKDLPVPKPKPNEILI
NVRYSGVCHTDLHAWHGDWPLGAKLPLVGGHEGAGVVVAKGSSVTNFEIGDYAGIKWLNG
SCMSCEFCEQGNESNCAKADLSGYTHDGSFQQYATADAIQAAQIPKGTDLAQVAPILCAG
VTVYKALKDSDVKPGQWVAISGAAGGLGSLAVQYAKAMGMRVLGIDAGDEKRKLFESLGG
NHFVDFTKTKDLVSEIQEITEGGPHGVINVSVSEKAIGQSVEYVRPCGTVVLVGLPAGAT
VKSDVFNHVIKSINIKGSYVGNRADTREAIDFFAKGQVKSPIKVVGLSELPEVYKLMEAN
KIIGRYVVDTSR
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgtttactcgagttgctgctgctgccagaattcaatccagaagacctctaagactgagg
ttgcaatctacactgtcaattccacagtctcaaaagggtgttatattctatgagcatggt
ggtaagttggagtacaaagacctgcctgtccctaagccaaagcctaatgaaatcctgatc
aatgtcaggtactctggtgtgtgccacactgacttgcacgcttggcatggagactggcca
ttgggtgccaaattgccattggtcggtggtcacgaaggtgccggtgtcgttgtggccaag
ggttccagtgtcaccaacttcgagattggtgattacgccggtatcaagtggttgaacggg
tcctgtatgtcctgtgagttctgcgaacaaggtaacgagtccaactgtgccaaggccgac
ttgtccggttacacccacgacggttccttccaacagtacgcaacagctgatgccatccag
gccgctcaaattccaaagggcaccgacttggcccaagtggctccaattctgtgtgccggt
gtgaccgtctacaaggcattgaaggattccgacgtcaagccaggccaatgggtcgccatc
tcaggtgccgctggtggtctgggctccctagcagtgcaatacgccaaggccatgggtatg
cgtgtcctaggtatcgatgcaggtgatgagaagcgtaagctgttcgagtccctaggaggt
aaccacttcgtcgacttcaccaagaccaaagacctggtctcagaaatccaagagatcact
gaaggtggtccacacggtgtcatcaacgtctctgtctcagagaaggccattggccaatcc
gtcgagtacgtcagaccatgcggtaccgtggtgctggttggtctaccagctggtgccact
gtcaagtccgacgtgttcaaccatgtcatcaaatccataaacatcaagggttcttacgtt
ggtaacagagccgacacaagagaagccatcgacttcttcgctaagggccaagtcaagtcc
cctatcaaggtggttggtctatccgagctgccagaagtctacaaactgatggaagccaac
aagattatcggaagatacgtcgtcgacacgtccagataa

DBGET integrated database retrieval system