KEGG   Candida glabrata: CAGL0J02068gHelp
Entry
CAGL0J02068g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
cgr  Candida glabrata
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:cgr04141]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
J:207414..209540
Genome map
AA seq 708 aa AA seqDB search
MLYSYLWSFMWLLAIACARPPPKVDERNDKPPRGFPLPLNKKNFEVELSNGFHLVEFYSP
YCSHCKNLAPIWEDTWVSFREEGKKLNMKLSQVNCVESGDICHKEDIRAYPTIRLYGPDG
FLEEYHGKRTKEEFLKFARKSIMEYGDTDDLILPSLSKLLSGKDFSQLISGKSTKPMLVS
FWPTSDMQEDSSVETKFNNCPKCEIYQRKWNLINNAVDGLGVDSGHLNCGSEQNLCERLG
FADLASSAKSGGNVKPRLALIIPKKVTNNLFIYPEGQDVSNQADVLDFIKRISVNSEAAE
ISESEIIDYSRNSMPLFSEFVHTNAKKVHSGQNIYIIFCYNHKTVVPEDFTILEHLVEPL
ASRPNTYLRKFNGTIPELTKKVYDPFYQVVNYNDSEPRKELNEEFQTMAAVTEYPTFLII
KEGELQTHVFNGFSTTEMRNLDTILDWIDDTIVPSLPKLTWDNFEEMLNVNPSKYRTMAI
LLMSTKWEYDDKVNAAQKFFTSFLDYEHVRMQKMFEIVQQERLKKANAIEKMREKQENTK
NILAKMRQEISHPNDRKVQYMYLDLAKDERLLKRLGVHNANIAPNQVLLIDKARKTLYAE
NHFEERLTGKDTYGIREALLSINIPEKCQLSTILRAQHLKIKLQKKIKIPHVKVSNGSNS
NILYFFAILLLLVLLRKSPVYRMVSRKWHSHRASYQANTSYSKLEAQD
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgttgtatagctatttgtggtcatttatgtggctgttggccatagcttgtgcgagacca
cctccgaaagtagatgaaagaaatgacaagccacctcgaggatttcctctccctttgaat
aagaagaattttgaggttgaattatccaacggtttccatctagtggaattctacagtcct
tactgtagtcattgtaagaatttggccccaatttgggaagacacctgggtttcatttaga
gaggaagggaaaaaactaaacatgaagctatctcaagtaaattgtgttgaaagtggcgat
atatgtcataaagaagacattagagcgtatccaaccatcagattatatggtccagatgga
tttttagaggagtatcacggtaagagaactaaggaggaattcttgaagtttgccaggaag
agtattatggagtatggtgatacagatgacctgattctaccttcattaagtaagttgttg
agcggaaaagactttagccagttaatttctggtaagtccacgaagcctatgctagtatca
ttttggcctacttctgatatgcaggaagacagctctgtggaaactaaatttaacaactgt
ccgaaatgcgaaatatatcaaaggaagtggaatttaataaataatgctgttgatggtctt
ggagttgattcaggtcatttaaattgtggttcagaacaaaatctatgtgaaaggttaggt
tttgcagaccttgcatcatcagcaaaatcaggaggtaatgtaaagccaaggttagcatta
attattccaaaaaaagtaacaaataatttgttcatatatccagaaggtcaggatgtgagt
aaccaggccgatgttctggacttcattaaaagaatttcagttaacagtgaggcggcagaa
atttcggaaagtgaaatcattgactattctagaaattctatgccgttgttttctgaattt
gtgcacaccaatgcaaagaaagtgcattcgggacaaaatatctacattattttttgttac
aaccacaagactgttgtacctgaagactttactatactagagcacttagtagaaccatta
gccagtcgcccaaatacatatttacgcaaattcaatggtactattcctgagttaactaaa
aaggtttatgatcctttttaccaagtagtgaattataatgactcagaaccaagaaaggaa
ttgaatgaggagtttcaaactatggcagctgtcacagaatatccaacattcttaattatt
aaggagggtgaattacaaacgcacgtatttaatggcttctctacaactgagatgagaaac
ttagatactatattagattggattgatgatacgatcgtgccatcgttgccaaaattgaca
tgggataactttgaagagatgttgaatgtgaatccatcgaaataccgtactatggctatt
ttgttaatgagtacaaaatgggagtatgatgacaaagtgaatgctgcgcaaaagtttttt
acttctttcctagattatgagcatgttagaatgcaaaagatgtttgaaattgttcaacag
gaaaggttaaaaaaagcaaatgctatagagaaaatgcgagagaaacaagaaaatacaaag
aatattctagcaaaaatgagacaagaaatcagccatcctaacgataggaaggttcagtat
atgtacttagatttggctaaagatgagcgactactgaagaggcttggagttcataatgct
aacattgctcctaaccaagttctcctgatagataaagcacgcaagacattatatgccgaa
aaccattttgaggagagattaactggcaaagatacatatgggataagagaagccttatta
tctattaatattccggaaaaatgtcaactatctactatcctaagggctcaacatcttaaa
ataaaactacagaagaaaatcaaaattcctcatgttaaagtttccaatggaagtaattcc
aatatattgtatttctttgctattttgttattattggtactattgaggaaatcacctgtt
tatcgtatggtaagtagaaaatggcattcgcatcgagcatcatatcaggctaatacttct
tatagcaaacttgaggcccaggactaa

DBGET integrated database retrieval system