KEGG   Candida glabrata: CAGL0J03058gHelp
Entry
CAGL0J03058g      CDS       T01024                                 

Definition
(RefSeq) hypothetical protein
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
cgr  Candida glabrata
Pathway
cgr00630  Glyoxylate and dicarboxylate metabolism
cgr01100  Metabolic pathways
cgr01110  Biosynthesis of secondary metabolites
cgr01200  Carbon metabolism
Module
cgr_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CAGL0J03058g
Enzymes [BR:cgr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     CAGL0J03058g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-GeneID: 2889724
NCBI-ProteinID: XP_447837
UniProt: Q6FPK7
Position
J:complement(292534..294195)
Genome map
AA seq 553 aa AA seqDB search
MPVPNSEANEFQALQARIDADAKEIEQWWSEPRWNKTKRTYSAREIAIRRGTFPPLTYPS
SVMAKKVYKVLEKHHKEGTVSRTFGALDPVQVSQMAKFLDTIYVSGWQCSSTASTSNEPG
PDLADYPMDTVPNKVEHLFKAQQFHDRKQWENRAKATSQEELDAMGPAIDYMTPIIADAD
AGHGGLTAVFKLTKMFIERGAAGIHMEDQTSTNKKCGHMAGRCVIPVQEHINRLVTIRMC
ADIMHSELVIVARTDSEAATLISSTIDTRDHYFVVGATNPDIEPFAEYMDRAIMAGVSGD
ELQKLEAAWIEKAGLKLFHEAFADEVNKSSVSNKQEIIKKFNDKVGPLTETSHREAKKLA
KELLGKDIFFDWDLPRVREGLYRYRGGTQCSVMRARAFAPYADLVWMESNYPDFEQAREF
AEGVKAKYPDQWLAYNLSPSFNWPKAMSVDEQATFIERLGQLGYIWQFITLAGLHTTALA
IHKFSEDFAREGMKAYAQNVQQIEMDEGVDVLKHQKWSGAEYIDGLLKLAQGGVSATAAM
GQGVTEDQFKSNL
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtgcctaactcagaagctaacgaattccaagctttgcaagcccgcatcgacgcc
gatgctaaagaaatcgaacagtggtggtccgagccccgctggaacaagaccaagagaact
tactccgcaagagagatcgccatcagacgcgggactttccctcctctgacttacccttcc
tccgtaatggccaagaaggtctacaaagtgctagagaaacaccacaaggaaggtaccgtg
tcccgtaccttcggtgccctggacccagtccaagtctcccagatggccaagttcctagac
accatctacgtctccggctggcagtgctcctccaccgcttccacttcaaacgagccaggc
ccggacttggctgactaccctatggacaccgtgcccaacaaagtcgaacacttgttcaag
gcacagcagttccacgacaggaagcagtgggagaaccgcgctaaggccacctcacaggag
gagctcgacgccatgggacccgccatcgactacatgacccccatcatcgccgacgccgac
gccggccacggtggcctcacagccgtcttcaagctgaccaagatgttcatcgagcgcggc
gcagccggtatccacatggaggaccagacgtccaccaacaagaagtgtggccacatggcc
ggcaggtgtgtcatcccagtccaggagcacatcaacagactggtcaccatcagaatgtgc
gcggacataatgcactccgagctggtgatcgtcgcaagaaccgactcagaggccgccacg
ctgatcagctccaccatcgacacccgcgaccactacttcgtcgtcggcgccacgaaccca
gatatcgagcccttcgccgagtacatggacagggccatcatggccggcgtctccggtgac
gagctgcagaagctggaggccgcctggatcgagaaggccggcctgaagctgttccacgag
gccttcgccgacgaggtcaacaagtcctccgtctccaacaagcaagagatcatcaagaag
ttcaacgacaaggtcggcccactgaccgagacctcccaccgcgaggccaagaagctcgcc
aaggaactgctcggcaaggacatcttcttcgactgggacttgccaagagtcagagagggc
ctgtaccgctaccgcggtggcacccagtgctccgtgatgagagcccgtgccttcgctcca
tacgccgacctggtctggatggagtccaactacccagacttcgagcaagcccgcgagttc
gccgagggcgtcaaggccaagtacccagaccagtggctagcctacaacctgtccccatcc
ttcaactggcctaaggccatgtccgtggacgagcaggccactttcatcgagagactgggc
caactgggctacatctggcagttcatcaccttggcaggcctgcacaccaccgcgctggcc
atccacaagttctccgaggacttcgccagggaaggcatgaaggcgtacgcccaaaacgtc
cagcagatagagatggacgaaggcgtcgacgtgctaaagcaccagaagtggtccggtgcc
gagtacatcgacggcctactgaaactagcacaaggtggtgtcagcgccaccgcggccatg
ggccaaggtgtcacagaggaccaattcaaatccaacttgtaa

DBGET integrated database retrieval system