KEGG   Candida glabrata: CAGL0J03058gHelp
Entry
CAGL0J03058g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
cgr  Candida glabrata
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CAGL0J03058g
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CAGL0J03058g
Enzymes [BR:cgr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     CAGL0J03058g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
J:complement(292534..294195)
Genome map
AA seq 553 aa AA seqDB search
MPVPNSEANEFQALQARIDADAKEIEQWWSEPRWNKTKRTYSAREIAIRRGTFPPLTYPS
SVMAKKVYKVLEKHHKEGTVSRTFGALDPVQVSQMAKFLDTIYVSGWQCSSTASTSNEPG
PDLADYPMDTVPNKVEHLFKAQQFHDRKQWENRAKATSQEELDAMGPAIDYMTPIIADAD
AGHGGLTAVFKLTKMFIERGAAGIHMEDQTSTNKKCGHMAGRCVIPVQEHINRLVTIRMC
ADIMHSELVIVARTDSEAATLISSTIDTRDHYFVVGATNPDIEPFAEYMDRAIMAGVSGD
ELQKLEAAWIEKAGLKLFHEAFADEVNKSSVSNKQEIIKKFNDKVGPLTETSHREAKKLA
KELLGKDIFFDWDLPRVREGLYRYRGGTQCSVMRARAFAPYADLVWMESNYPDFEQAREF
AEGVKAKYPDQWLAYNLSPSFNWPKAMSVDEQATFIERLGQLGYIWQFITLAGLHTTALA
IHKFSEDFAREGMKAYAQNVQQIEMDEGVDVLKHQKWSGAEYIDGLLKLAQGGVSATAAM
GQGVTEDQFKSNL
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtgcctaactcagaagctaacgaattccaagctttgcaagcccgcatcgacgcc
gatgctaaagaaatcgaacagtggtggtccgagccccgctggaacaagaccaagagaact
tactccgcaagagagatcgccatcagacgcgggactttccctcctctgacttacccttcc
tccgtaatggccaagaaggtctacaaagtgctagagaaacaccacaaggaaggtaccgtg
tcccgtaccttcggtgccctggacccagtccaagtctcccagatggccaagttcctagac
accatctacgtctccggctggcagtgctcctccaccgcttccacttcaaacgagccaggc
ccggacttggctgactaccctatggacaccgtgcccaacaaagtcgaacacttgttcaag
gcacagcagttccacgacaggaagcagtgggagaaccgcgctaaggccacctcacaggag
gagctcgacgccatgggacccgccatcgactacatgacccccatcatcgccgacgccgac
gccggccacggtggcctcacagccgtcttcaagctgaccaagatgttcatcgagcgcggc
gcagccggtatccacatggaggaccagacgtccaccaacaagaagtgtggccacatggcc
ggcaggtgtgtcatcccagtccaggagcacatcaacagactggtcaccatcagaatgtgc
gcggacataatgcactccgagctggtgatcgtcgcaagaaccgactcagaggccgccacg
ctgatcagctccaccatcgacacccgcgaccactacttcgtcgtcggcgccacgaaccca
gatatcgagcccttcgccgagtacatggacagggccatcatggccggcgtctccggtgac
gagctgcagaagctggaggccgcctggatcgagaaggccggcctgaagctgttccacgag
gccttcgccgacgaggtcaacaagtcctccgtctccaacaagcaagagatcatcaagaag
ttcaacgacaaggtcggcccactgaccgagacctcccaccgcgaggccaagaagctcgcc
aaggaactgctcggcaaggacatcttcttcgactgggacttgccaagagtcagagagggc
ctgtaccgctaccgcggtggcacccagtgctccgtgatgagagcccgtgccttcgctcca
tacgccgacctggtctggatggagtccaactacccagacttcgagcaagcccgcgagttc
gccgagggcgtcaaggccaagtacccagaccagtggctagcctacaacctgtccccatcc
ttcaactggcctaaggccatgtccgtggacgagcaggccactttcatcgagagactgggc
caactgggctacatctggcagttcatcaccttggcaggcctgcacaccaccgcgctggcc
atccacaagttctccgaggacttcgccagggaaggcatgaaggcgtacgcccaaaacgtc
cagcagatagagatggacgaaggcgtcgacgtgctaaagcaccagaagtggtccggtgcc
gagtacatcgacggcctactgaaactagcacaaggtggtgtcagcgccaccgcggccatg
ggccaaggtgtcacagaggaccaattcaaatccaacttgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system