KEGG   Candida glabrata: CAGL0J03454gHelp
Entry
CAGL0J03454g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
cgr  Candida glabrata
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
J:complement(332090..334171)
Genome map
AA seq 693 aa AA seqDB search
MGVELKQEPGESKRKLEDDVASQDVKRPVIVPTRKAQIHYTPLKTGICYDVRMRYHAKIF
TSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIRAATAEEILE
VHSKEHLEFIEKTEKMNREELLKETEKGDSVYFNNDSYATSRLPCGGAIEACKAVVEGRV
KNSLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQ
KAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYMW
AFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVV
LEGGYNLDAIAISALSVAKILIGEPPDELPDPLREPKAEALEIIDKVISLQSKYWKCFGK
RYGNLGLPSENVVKALMMSKSFPLQTAIRQEQFHQLSEDFGFVTLPLLNMEVPQDSVICS
PNLFNETTILVVVHDTPEIWAKRNVITGTIDPSTSLVVDSGAEFIKWGLERKYGIMDINI
PQSLFEQENYTAVLTSQEILIYIWDNYLKFFPSLTKVAFIGIGDASAGIVHLLGHRDTRS
VVKSVVSFIGKKSLKPLVPLVNESLGDWYFKNSLVFTDHSHSCWGDNENRKPRKKFGRVL
RCDAEGMNNIIEERLEESTDFILDSFEEWSDSE
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgggtgttgaattgaagcaggagcctggggaatcaaagcgtaagttagaggatgatgtt
gcaagtcaggatgttaaaaggccagtgattgtgcctacccgcaaggctcaaatacattat
actccattgaagactggtatatgttatgacgtgaggatgcgttaccatgcgaaaatcttc
acttcatatttcgagtacattgatccacatccagaggatcccaggagaatataccgtatt
tacaaaattctggcggagaatgggttgataaatgatcctacccttagcggtgttaacgat
attggtgatttaatgttgaagatacctattagagcagctacagctgaagagatcctagaa
gtgcactcgaaggagcacttggaatttatagaaaagacggaaaagatgaatcgtgaggag
ttgctgaaggaaacggagaaaggagattctgtatattttaataacgactcgtatgctact
tcgaggttaccatgtggaggtgcaattgaggcatgtaaagctgtggtggaaggtagggtt
aagaactcactggctgtggttagaccacctggtcatcatgctgagcctgaagctgcaggt
gggttttgtttgttctctaatgtagcggtggccgctaaaaacattttaaaaaattaccct
gagagtgtacgcagaatactgattctggattgggacgttcatcatggtaatggtactcag
aaggcattttatgacgatgatagagttttatatatatcacttcacagattcgagctgggc
aagtattatccaggtacaattcaagggcagtatgatcagataggtgaaggtaaaggtaaa
ggttttaattgtaatattacatggccagttggaggtgttggtgacgcggaatacatgtgg
gcttttgaacaagtagtcatgccaatgggaagagaattccaaccagatttggtgatcata
tcgtctggttttgatgcagcagatggtgatacaatcggccaatgccacgttactcctagc
tgttatgggcatatgacacatatgttgaaatctctggcaagaggtaatttatgtgttgtc
ttggaaggtggttataacctagatgcaattgccatcagtgccctctctgtagcaaagata
ttaataggagaaccaccagatgagttaccagatcctctgagagaacctaaagctgaagct
ttggaaataatagataaagttatcagcttacaatctaagtattggaaatgttttggaaaa
agatatggtaatttaggacttccatccgaaaatgtcgtcaaagctctgatgatgtcaaag
agttttcctttacagactgctattcgccaagagcaattccatcagctttctgaagatttt
ggatttgtaacactaccactccttaatatggaagttccacaagatagcgtcatctgttca
cctaatttatttaatgaaactactattttggttgttgtacatgatacaccagaaatatgg
gccaagagaaatgttattactggtacaattgacccatcaacatctctggttgttgattca
ggagccgaatttattaaatggggattagaaagaaagtatggtattatggatatcaatatc
cctcaatctctatttgaacaagaaaattatactgctgtgttgacatcgcaagagatattg
atatatatatgggacaattatctgaagttttttccttctttaactaaggtggcctttatt
ggtattggtgatgcttcagcaggaatcgttcatttacttggtcacagagatacaagaagt
gttgtcaaatcggtcgttagtttcattggtaaaaaatcattgaaacctttagtcccatta
gtgaacgaatcactgggagattggtactttaagaattctttagtttttacagatcatagc
cacagctgttggggagacaatgaaaataggaagcctagaaagaagtttggacgtgtgtta
aggtgtgacgccgaaggaatgaataacatcatagaagaaagacttgaggaatctacagat
ttcatcttagattctttcgaagaatggagtgacagtgaatga

DBGET integrated database retrieval system