KEGG   Candida glabrata: CAGL0J04290gHelp
Entry
CAGL0J04290g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
cgr  Candida glabrata
Brite
Enzymes [BR:cgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CAGL0J04290g
Protein kinases [BR:cgr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CAGL0J04290g
Exosome [BR:cgr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CAGL0J04290g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
J:complement(403542..404615)
Genome map
AA seq 357 aa AA seqDB search
MGKKIVFNISSDFQLKSLLGEGAYGVVCSAVHKPTGEIVAIKKIVPFDKPLFALRTLREI
KILRRFQHENIISIFDIQKPESFEKFNEVYIIQELMQTDLHRVIATQTLTDDHIQYFIYQ
TLRAIKTLHGSNVIHRDLKPSNILINSNCDLKVCDFGLARIIDSGENGDNEVDKIGMTEY
VATRWYRAPEVMLTNAKYSRAMDIWSCGCILGELFLKRPLFPGKDYRHQLLLIFGLIGTP
DSSDKSMECIESRRARQYIASLQKYPPVRPLQKAFPGVNPVGVDLLSRMLVFDPRERISA
DDALAHPYLSTYHVPEDEPAGEPIPPDFFQFDQYKEVLTTKDLKKLLWNEIFHEQAT
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagaaaattgtcttcaacatttccagcgacttccaacttaaatcactgttggga
gaaggcgcttatggagttgtttgttctgcggttcataagcctacgggtgaaattgtagct
ataaagaaaattgttccatttgataagccgttgtttgcattgcggacattaagggaaata
aagatactaagaaggtttcaacatgaaaatataatttcaatctttgatatacagaaacca
gaaagttttgagaaatttaacgaggtctacattattcaagagttaatgcaaactgattta
catcgagtcattgccacacaaacactaactgatgatcacatccaatattttatctatcaa
actttaagggcaatcaaaacattgcatggatcaaatgttatacaccgtgaccttaaacct
agtaatatattgatcaactcaaattgtgatttaaaggtttgtgactttggattagctagg
ataatagatagcggggagaatggtgataatgaggtcgacaagatcggaatgacggaatat
gttgcaactcgatggtatcgagcaccagaagtgatgttaacaaatgccaagtattcaaga
gcgatggacatatggtcttgtggatgcatacttggggagttatttttgaaacgaccacta
tttcctgggaaggattacagacaccaattgttgctaatttttggattaattggtacgcca
gactcatctgacaaaagcatggaatgcatagagtcgagaagagcgagacaatatattgca
tctctgcaaaaatatccgcctgttcggccattgcagaaagcatttccgggagttaatccc
gtgggtgtggatcttttatctcgcatgctagtatttgaccctagagagcgaatatcagct
gatgacgctttggcacatccttatctgtctacttatcatgttccagaggatgagcctgcc
ggtgaacctatacctcctgatttctttcagtttgatcagtacaaggaagttcttaccaca
aaggatctaaagaaattgttgtggaacgaaatctttcatgaacaagcaacttaa

DBGET integrated database retrieval system