KEGG   Candida glabrata: CAGL0J06842gHelp
Entry
CAGL0J06842g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
cgr  Candida glabrata
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:cgr03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:cgr03420]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
J:complement(657226..658740)
Genome map
AA seq 504 aa AA seqDB search
MSFSGLKHSITQYLEEIPSQVQTRLYKSPATCLAIYRLLPTLAKFFIMTVIFNDKDISLR
DLDRWVKSNGKLQFQEAIKSMKSLHLLIPTRVNGQLLINLNPTFRESFRNALTGGEVNNS
FGIVVDEDRLDTVVNLAVLDEYAATKWETILHFMVGTPMAKMPSENVLNLLKHSKLMEEV
PDSSEFMITNEGFQFLLQEVNSQIWSLLLQYLKLAESLHMDPVHVLNFIFMLGALETGKA
YSTENLSETQLKMLLDMRDYGLVFQKTSNPNIFYPTRLAQMLTSDTKSMRTASGAMESVL
NKPDDAAKSTDDKYDSLEGKAEDIQDGALIIETNFKLYSYCNSPLQIAILSLFVHLKSRF
ANMVAGQITRESIRRALINGITADQVIAYLESHAHPQMRRLAEEKLQKKLELDPNCKDPL
QVLPPTVVDQIKLWQLELDRVLTYEGSLYIDFDTAQDFNMLCKYAQDIGALLWKDDRKRK
LFVSREGNAQVLEYAKRKIKKKEE
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcagtggtctcaagcactcgattacacagtacttggaagagataccaagccaa
gtgcaaacaagactgtataaatccccggctacatgcttggctatttacagacttctgccg
acactggcaaagtttttcataatgacagttatattcaatgataaagatatatcattacgt
gacctggatcgttgggttaaatcgaacggcaagctacaatttcaagaggctatcaagtca
atgaaatctttacatttgctgataccgacaagggtaaatgggcaacttttaatcaacttg
aatccaacatttagagaaagtttcagaaatgcgttaacaggtggtgaagtgaacaactca
tttggtattgtagttgatgaagatagactcgacaccgtggtaaacttagctgtcctagat
gaatatgcagcaacgaaatgggagacaattttacattttatggtcggtactccaatggca
aaaatgccatcggaaaatgttcttaatctattaaaacatagcaaattaatggaagaagtt
cccgactcctctgagtttatgattactaatgaaggttttcaattccttctacaggaagtt
aactcacaaatctggtcattacttttacagtatctgaaactagccgaatcattgcatatg
gacccagttcatgtcttgaactttatctttatgctaggtgctttagagactggaaaggca
tatagcacagaaaacctcagcgaaactcaattaaaaatgcttctcgatatgagagattat
ggtctagtgtttcaaaaaacaagtaatcctaatatattctatccgacacggttggcacaa
atgttgacgtcagatactaagagcatgagaacagcatctggtgctatggagagtgttcta
aacaaacctgacgatgcggcaaaatcaacggatgacaaatatgattcattggaaggtaaa
gctgaggatatacaagatggtgctctgattattgaaaccaacttcaaactatactcatac
tgcaactcacccttacagatagctattctaagtttatttgtgcatttgaaatctagattt
gctaatatggtggctggtcaaattacaagagaatctatcagaagagctttaatcaatggt
atcactgctgatcaggtaattgcttatttagaatctcatgcgcatcctcagatgagaaga
ttagctgaggaaaaactgcaaaagaaattagaactagatcccaactgtaaagatcccttg
caagtgctacccccaaccgtcgtcgatcaaattaaattatggcaactagaattagataga
gtgttaacgtatgaaggttctctatacattgactttgatacagcacaagatttcaatatg
ctctgtaaatatgcacaggatattggcgctctactatggaaagatgataggaagagaaaa
ctatttgtttctagagagggtaatgctcaagttctagagtatgcaaaaaggaaaatcaaa
aagaaggaagaataa

DBGET integrated database retrieval system