KEGG   Candida glabrata: CAGL0J10186gHelp
Entry
CAGL0J10186g      CDS       T01024                                 

Definition
(RefSeq) hypothetical protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cgr  Candida glabrata
Pathway
cgr00010  Glycolysis / Gluconeogenesis
cgr00020  Citrate cycle (TCA cycle)
cgr00620  Pyruvate metabolism
cgr01100  Metabolic pathways
cgr01110  Biosynthesis of secondary metabolites
cgr01130  Biosynthesis of antibiotics
cgr01200  Carbon metabolism
Module
cgr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAGL0J10186g
   00020 Citrate cycle (TCA cycle)
    CAGL0J10186g
   00620 Pyruvate metabolism
    CAGL0J10186g
Enzymes [BR:cgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CAGL0J10186g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding PMSI1 DUF3614
Motif
Other DBs
NCBI-GeneID: 2889413
NCBI-ProteinID: XP_448154
UniProt: Q6FNP0
Position
J:complement(997347..998756)
Genome map
AA seq 469 aa AA seqDB search
MSALLRALPQVSRTALRGRLVTPMTLRLYASFPPHTVIGMPALSPTMSQGNLAVWSKKEG
DSLAPGDVLAEIETDKAQMDFEFQDEGYLAKILVPAGTKDVAVSRPIAVYVEDEADVAAF
KDFTVEDAGGSQSSSAPAAEEQKEEPKKEEVKEEKSEKKAAKSNSTPSSVASGDRIIASP
LAKTIALEKGIALKSVKGTGPRGRITKADVEKYLESAPKSTSTAAPSATPSTTGGASYED
LEITNMRQIIGDRLLQSRQSIPSYIVSSDISVSKLLKLRKSLNATAKDQYKLSINDILIK
AVTVAARRVPDANSYWLQNEGIIRQFKNVDVSVAVATPTGLLTPIVKNAESKGLIEISKE
VKELASRAKINKLVPEEFQGGTICISNLGMNPAVSMFTSIINPPQSTILAIGTVKRVAVE
DAGAENGIAFDDQVTITGTFDHRTIDGAKGADFMRELKTVIENPLQLLL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcattattgagagcattgccccaagtctctaggactgccttgagaggccgtcta
gttactccaatgacattgagattgtatgcatctttcccacctcacactgtgataggtatg
ccagcgttgtctccaacgatgagtcaaggtaacttggctgtgtggtctaaaaaggaaggt
gattccttggctcctggtgatgtcctagccgaaattgagaccgataaggctcagatggac
tttgagttccaagacgaaggttatctggcaaagattctggtcccagccggtaccaaggat
gttgctgttagcagaccaattgctgtgtatgttgaagatgaagcagatgttgctgcattc
aaagactttacagtagaggatgctggtggatctcagtcttcatccgctccggcagccgag
gaacaaaaggaagaaccaaagaaggaagaagtgaaagaggagaaatctgagaagaaggct
gcaaagtctaattctacaccctcttcagttgcttcaggtgacagaatcattgcctctcct
ctagcgaagactattgctctagagaaaggtattgctttgaagagtgtcaaaggtactggt
cctcgtggccgtatcactaaggccgatgtcgagaagtacttggaaagtgcgccaaagagc
acttctactgctgcaccatcggccactccttctaccactggaggtgcttcctatgaagac
ttggagattactaatatgagacaaattattggtgaccgcttgctacaatccagacaaagt
attccatcatacattgtttcatctgatatttctgtctccaagttattaaagctaagaaag
tccttaaatgctacagccaaggaccaatataagctatctatcaatgatatcttgatcaag
gctgtcacggtagcagctagaagagtaccagatgctaactcttattggcttcaaaatgag
ggtatcatcagacaattcaagaatgtcgacgtctctgttgctgttgctacaccaactggt
cttttgactcctattgttaaaaatgcagagtctaagggcctaattgaaatttccaaggaa
gtcaaggaattggcttcccgtgccaagatcaacaagcttgtaccagaagaattccaaggt
ggtactatctgtatttctaacttaggtatgaaccctgcagtatcaatgttcacttctatc
ataaacccacctcaatccaccatcttggccatcggtactgtaaagagagttgctgtcgaa
gacgctggtgctgaaaacggtatcgcattcgatgaccaagtcacaataacaggtacattt
gaccacagaaccattgacggtgctaaaggtgctgatttcatgagagaattgaagaccgtt
attgaaaacccattgcagttactattgtag

DBGET integrated database retrieval system