KEGG   Candida glabrata: CAGL0J11352gHelp
Entry
CAGL0J11352g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K11873  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
cgr  Candida glabrata
Brite
Enzymes [BR:cgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CAGL0J11352g
Peptidases [BR:cgr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CAGL0J11352g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
J:complement(1103473..1105788)
Genome map
AA seq 771 aa AA seqDB search
MTTQETIKPLVDRILNNPLQFRRSTASPNISNKDTDMNGNSDSPYIVIGKRKLADQNSKN
NGKSDPNQRQSDENDSSEIVQKKRKMPTSVAEALNWYTNAALKDKTPKVKALPIVKDDST
SDRKGAIEKQADSNSSDSSDTDVFHEAVDFIEEPVKDLGAANVEITSQQDEDTGEDLGED
LGEDLGEDLGEDLGEDLGEDLGEEIKKVIKETEQNTKVKESTNEVPNVQAAIPKIEPTKK
KRKSSVSKELSLLQRDNEDYEREQLMIKQIKEQREKARKQDEELQQNKSKKTENSSQSQE
KQKEGKDPETKDQQQAQEEVTETKHEEKDTFAESISPKKSVTPPSTIPDISEFYQFNENF
DDKGCLENSSIVKSWGPTYSKLKPKGLLNHGVTCYTNAAVQALLHIPAMQHYLNDILAGK
YSSTISSNSVSHVLAETSRRMWHNDGKKSGNSYINPKKLIARLDDINCMMSEWQQEDSHE
YFMSIMSRLQEDSVPKGHKMTESIIYDIFGGSLKQTVTCKSCGEVSTTEQPFYDLSLHLK
GKKTDENTVNQEKSSSQSETKDSDSQTSRYSIEKSIRDFFNPELIKVDKEKKGYVCEKCH
KTTNALKRNSILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPMFLDMTEYCEESKKMLPV
KYELLSVVVHEGRSLSSGHYIAHCKQPDGSWATYDDEYINKITEREVLKERNAYYVLYTR
LTPKSVQLNEPKKQSTPNPITNVKQNNGKNNKSNKRSSNKKNWKKNKRRRL
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atgactacacaagagactatcaagccactggttgataggattcttaataatcctctacag
ttcagaagatcaaccgctagcccaaatataagcaataaggacacagatatgaatggcaat
agtgactctccgtatattgtgatcggtaagcggaagcttgctgaccaaaatagcaagaac
aatgggaagtctgatccaaaccaaaggcagagcgatgagaatgattcctctgaaattgta
cagaagaaaagaaagatgcctacttcagtggctgaagccttgaattggtataccaacgca
gcacttaaggataagacacctaaagtaaaagcactgccgattgtaaaagatgactcgacc
agcgatagaaaaggtgcgattgagaaacaggccgacagcaatagcagtgacagttctgat
accgatgtctttcatgaagctgtcgattttatcgaagagcccgttaaggatcttggtgcc
gccaatgttgagataacttctcaacaggacgaggatacaggagaagatctaggagaggac
ctaggagaagatctaggagaggatctaggagaggatctaggagaggatctaggagaggat
ctgggagaggagattaaaaaggtcattaaagaaactgaacaaaatacgaaagttaaagaa
tctacgaatgaagtgcctaatgtacaagccgctataccaaaaatcgagccaactaagaaa
aagaggaaaagctctgtatctaaagaactgtcattgttgcagagagataacgaggattat
gagcgcgagcagctcatgataaagcaaataaaagagcaaagagaaaaagcacgtaaacaa
gatgaagaattacaacaaaataagagtaaaaaaacagaaaatagctcgcaatcacaagaa
aaacaaaaggaaggcaaagatccagagactaaggaccagcagcaggcacaagaagaagtt
acagaaacaaagcatgaagagaaggatacttttgcagaatcaatttctcccaaaaagtcg
gtcactcctccatccacgatacctgatatatcagaattctatcaatttaatgagaatttt
gacgataaaggttgtttagagaattcttcaatcgtaaaaagttggggtcccacttacagt
aaactaaaacctaaaggactattaaatcacggtgtcacttgctatactaacgcagctgtt
caggctctattgcatatcccagcaatgcaacattatctaaatgacattttagcaggaaag
tactcatccacaatatcttctaattcagtttcccacgttctagcagaaaccagcaggaga
atgtggcacaatgatggaaaaaaatccggcaactcttacataaatccgaagaagctaatt
gcacgtctagacgacatcaactgcatgatgagcgaatggcaacaggaagactcacacgaa
tactttatgtctatcatgtctagactacaggaggattccgtccctaaaggtcataagatg
actgaatcaattatatatgatatatttgggggttctttaaagcaaactgtcacctgcaag
tcgtgtggagaagtatcaactaccgagcaaccattttatgatctgtcgctgcatttgaag
ggtaaaaagaccgatgagaatacagtaaaccaggagaaaagctcttctcaaagcgaaacc
aaggatagtgattcacagacatcaagatattctatagagaaatctattagggatttcttt
aatccagaacttattaaggtcgataaggaaaagaaaggttatgtttgtgagaaatgtcac
aagactactaatgctctgaaaagaaatagtattctaagggccccagaaactttgcttgtt
catttgaaaaagttcagattcaatggcacatcttcgtccaaaatgaagcaagcggtttct
tatccaatgtttttggatatgacagaatattgtgaagagagcaagaagatgctaccagtg
aaatatgaactgctaagtgtagtagttcatgaaggtagatcattatcatctggccattat
attgctcattgcaaacaaccagatggttcctgggcaacttatgacgatgagtacatcaat
aagattacagagcgtgaagtgttgaaggagagaaatgcatattatgtgttatatactaga
ttaactcctaaaagtgtccaattaaatgagccaaaaaaacagtcaactccaaatcctatt
actaatgtgaaacagaataatggaaaaaacaacaagtcaaataaaaggtcctccaacaag
aaaaactggaagaaaaataaaagacgaagattataa

DBGET integrated database retrieval system