KEGG   Candida glabrata: CAGL0J11748gHelp
Entry
CAGL0J11748g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
cgr  Candida glabrata
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CAGL0J11748g
Enzymes [BR:cgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CAGL0J11748g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
J:complement(1143621..1145708)
Genome map
AA seq 695 aa AA seqDB search
MQLSVLIASVLAAGAAVDAASYTPQNVSCPDNANFIRNAADGLSPAEKEWLKKRDPITRD
ALQTFLRRAFANVSTEITSALFNDTENVPKLGIAVAGGGYRAMFVGAGAFAAMDNRTDGA
NEHGLGGLLQAATYMAGLSGGNWLTGTLAYNNFTSVQQILEEGDKADAIWNITNSFLNPY
DKDFSKTLARWTAIGSQVQGKRDAGFNVTITDLWSRALAYGWFPTLPNAGAGLTWSSLRD
NEIFMNGEMPMPISVADGRYPGTTVINLNATVFEMTPFEIGSWDPSLNAFSDIKYLGTQV
TDGKPETERCINGFDDASFIMGTSSSLFNEFTMSNDSAVAYTYLNTLSSTLVKGIDKENN
DIAMYAPNPFKGSKYVDSNYTTSIVDSDSLFLVDGGEDLQGIPFVPLLKQERDLDIIFAI
DVDTETSDNYPAGGPMMKTYERQFSKQGKGMAFPYVPDMTTFVNLGLGGKPSFYGCDANN
LTDLEYIPPLIVYIPNSYHSFESNVSTFKLNYNYSERVGMIRNAFEATTRNNLTEDADYV
TCVGCAIIRRKQQSLNLTLPDICDKCFTNYCWNGTIDNTPTKLLTPNNQDPAAISSAIAA
VTDDSPIGALLNTGSGTKSNSSSKTNSTLVTSSRATSTGTLISNSSSNSTVSSTAARSST
SSTAKKNAGSVLKLEFSKSASVMVAIAAAAVASLI
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgcaattgtcagttctaattgcctctgttcttgccgctggtgcagctgtcgatgcagct
agttacaccccacaaaatgtgagctgtcctgataacgctaattttatcagaaatgctgct
gatggtttgagtccagcagagaaggaatggttgaagaaaagagacccaattaccagagat
gcccttcaaactttcctaagacgcgcttttgccaatgtctctactgaaattacttcagca
ctattcaatgataccgaaaatgttccaaaattaggtattgctgtcgccggtggtggttac
cgtgctatgtttgttggtgctggtgcatttgcagccatggataacagaactgatggtgct
aatgaacacggtctaggtggtctattgcaagcagccacttatatggctggtctttctggt
ggtaactggctgactggtactttggcatacaacaacttcacctcagtgcaacagatcctc
gaggaaggtgacaaggccgatgccatctggaatatcacaaactcgttcttgaatccatac
gataaagatttctcgaagaccttggccagatggactgcaattggttctcaggttcaaggt
aaaagggacgcaggctttaacgttaccatcactgatttgtggtctcgtgcgttggcttac
ggttggttccctacattgccaaacgctggtgctggtttaacttggtcctctctaagagac
aacgaaatcttcatgaatggtgaaatgccaatgccaatttctgtcgcagatggtagatac
ccaggtaccaccgttatcaacttgaacgctactgtttttgaaatgactccattcgaaatt
ggttcatgggatccatccttaaacgctttcagtgacatcaaatacttgggtactcaagtc
actgatggtaagcctgaaaccgaaagatgtattaacggtttcgacgatgctagttttatc
atgggtacatcatcctcgttgttcaacgagttcaccatgagcaacgatagtgccgttgct
tacacttacttgaacaccctatccagcacattggtgaaaggtattgataaagaaaacaac
gacattgccatgtatgctccaaatccattcaaaggttccaaatacgtggacagcaactat
actacttccatagttgactctgattctttgttcttggtggatggtggtgaagatcttcaa
ggtatcccatttgttcctcttttgaagcaagagcgtgacctggatattatctttgctatt
gatgtagacactgagacaagtgataattatcctgccggtggtccaatgatgaagacatac
gaacgtcaattctctaagcaaggtaagggtatggctttcccatacgtccctgatatgacc
acttttgttaacctaggtctgggtggtaagccaagtttctacggttgtgacgccaacaat
ttgactgaccttgaatatatcccacctttaattgtttacattccaaacagttatcattcc
tttgaaagtaacgtttccacctttaaactaaactataactacagtgaacgtgttggtatg
attagaaatgctttcgaagccactaccagaaataatttgactgaagatgctgactacgtt
acatgtgttggttgtgcaatcattagacgtaagcaacaatctctgaacttaactctaccg
gatatttgtgacaagtgtttcaccaactactgttggaatggtactattgacaacacacca
acaaagcttctaacaccaaataatcaggatccagctgctatttcttctgctattgctgct
gtaactgatgactccccaattggtgccttgttgaacactggttctggtactaagtctaac
tcatcttcaaagactaactccactctagttacttcgagccgtgctactagtactggaact
ttgatttccaattctagttcaaatagtactgtttcctcaactgccgctagatcttccact
tcttctactgctaagaagaatgctggttctgtattgaagcttgagttttccaaatcagcc
tcagtaatggttgcaattgctgcagcagctgttgcatcgttgatttaa

DBGET integrated database retrieval system