KEGG   Candida glabrata: CAGL0K00979gHelp
Entry
CAGL0K00979g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
cgr  Candida glabrata
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    CAGL0K00979g
Enzymes [BR:cgr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     CAGL0K00979g
Glycosyltransferases [BR:cgr01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   CAGL0K00979g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
K:complement(98135..100327)
Genome map
AA seq 730 aa AA seqDB search
MVEDKLADEKTTETKENTPDQTKVVPRACNFAKYRDLIACLGFTVLSFVLRFQGIDKNNS
VVWDEAHFGKFGSYYIRHEFYHDVHPPLGKMLIALSEWLAGFDGEFDFESGHQYPDGVNF
KFMRQFNATFGALCTPVVFFTAKTMNLSWPIVYLVTLMVTLEHSFIALSKFILLDSMLLF
FTATTFACMVKLIQLRGCQLTRQWLWWLLLTGLSIGCVCSVKWVGLFITLVVGLFTIIDL
LEHYWNKKESRKIYYKHWILRIINLIIIPFLVYLFCFKIHFLLLYKSGTGDASTNSLFQV
NLEGTQIQNSPRTVMYGSEVTIRSHGLSPNLLHSHVQLYPDGSRQRQVTGYGHSDGNNNW
MIKFGRTTGRYLDEDNKRLNGELVPVRDGDTIRLFHVRMGCNLHSHTISSHVSKGNYEVS
GYGSEEVGDEKDDWIIEIMEQLDSANTNFGKEDNEVLHPISTMFRLRHKDLGCYLASTGL
SYPTWGFHQAEIVCKYSWGKRDKSTWWNVEDHWNDQLVVDEEYVPPKSKFWTDFILINFA
MASSNNALVPDEDKYDYLASKAWEWPILHKGLRLCGWSSAGVRYYLLGSPFNTWLSSIAL
LVNILLGMVVAIKWRRQSIVINEESCWKLFTLLLFPFLAWLANFMPYVMMGRVTYVHHYM
PALYFAIIAFGSITEYLLADYCTVKAFLAFLSMVGCTYIYWYFAPICQGLHGIGSHYFYL
QWLPGWDIAV
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atggtggaagataagttggccgatgagaagaccactgaaacaaaggaaaacacacctgac
cagacaaaggtagtacccagggcttgcaattttgcaaaatatagggacttaatagcgtgc
ctaggcttcacagttttgtcatttgtgttgcgtttccaaggtattgacaagaataattca
gttgtttgggatgaagcacattttggaaagttcggttcctactatataagacatgaattc
taccacgatgtgcatccacctttaggaaagatgttaattgccttaagtgagtggttggca
ggttttgatggtgaatttgattttgagtcaggacaccagtatccagatggtgtgaatttt
aagtttatgcgtcaatttaacgctacttttggtgcactatgtactcccgttgtcttcttt
actgcgaagacaatgaatctaagctggcctatagtatatttggtgactttaatggtgact
ttagagcactcctttattgcattatctaaatttatcctattggactctatgttattgttt
tttaccgctaccacgtttgcgtgtatggtgaaactaattcagttgcgtggctgtcaattg
actagacaatggttgtggtggttattactaactggtttatccattggttgtgtgtgttca
gtgaagtgggtgggattatttattacattagtcgtcggcctttttacgataatagattta
ttggagcattactggaacaagaaagagagccgcaagatctactacaagcactggatctta
agaataatcaatctcattataataccgttcttagtttatctgttctgtttcaagatacac
ttcctactattatacaaatctggtactggtgatgcttcaactaattcactattccaggta
aatttggaaggcacacagatacagaatagtcctagaacggttatgtatggttctgaagtc
actattagatcacatgggttgagcccaaatctgttacattcgcatgtccagttataccca
gatggctcccgccaaaggcaggtgactgggtatggtcactctgatggtaataataattgg
atgataaaatttggcaggaccacaggtagatatctagatgaagataacaaaaggttaaat
ggtgaacttgtacctgtaagagatggagatactatcagattatttcacgtcagaatgggt
tgtaacttacattctcacacaatctcctcccatgttagtaagggtaattatgaagtgtca
gggtatgggtctgaggaggtaggagacgaaaaggatgattggataatagagattatggag
caacttgattcggctaatactaactttggtaaggaggacaatgaagttttacaccctatt
tcgacaatgtttagattgcgtcataaagatttggggtgttacctagcgtctacaggactt
tcatacccaacatggggattccaccaagctgaaattgtgtgtaagtattcttggggtaag
cgcgataaatcaacttggtggaacgtcgaagatcactggaatgatcaattagtagtggat
gaggagtatgtgccacctaagtcaaagttttggactgattttattttaataaattttgct
atggcatcctcaaataatgcgcttgtgcctgatgaggataagtatgattatctagcatca
aaagcatgggaatggccaatccttcacaagggattgcgtttatgtgggtggtcgtcagca
ggtgttcgttattatttactaggatctccctttaatacatggctatcttctatagcgtta
ctggttaatattttgttgggtatggtagtagcaattaagtggcggagacaatccatagtg
attaatgaagaatcgtgttggaaactattcaccttattactgttcccatttttagcttgg
ttggcaaattttatgccatacgttatgatgggaagagttacttatgtacatcattacatg
cctgccttgtactttgcgattattgcctttggaagcataacggaatatctgctagctgat
tattgtacagtgaaggcatttcttgcatttttatctatggttggatgcacatatatttat
tggtatttcgctcctatatgtcaaggcctacatggtattggtagccattacttttatcta
cagtggttacctggttgggatatagccgtttaa

DBGET integrated database retrieval system