KEGG   Candida glabrata: CAGL0K01617gHelp
Entry
CAGL0K01617g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
cgr  Candida glabrata
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    CAGL0K01617g
Enzymes [BR:cgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     CAGL0K01617g
Protein kinases [BR:cgr01001]
 Serine/threonine protein kinases: Other group
  TTK family
   CAGL0K01617g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
K:complement(143308..145632)
Genome map
AA seq 774 aa AA seqDB search
MGNPYHSESDQIWRISSQDSDDGEIGNPPKLSNFGSELISDAIENINPNRSDKKLISEET
RIHESHSQQLNTDINQSTRVTHSASSPLYFEDTSPSTMFVQSQASAQPSATTYDISSQDY
SDSSKSFIKLKSKQDTLKQELTTRYSERRTRRFLHATNRTTKLGPALRNLTSPALAINDN
NSIDNKMNETSKVNSSFDTNNAYVDFHQTKQDIYTSGEEHNNTKDNGKIGATQQNDYSDI
NIHECNPIQYMKMHNLPTSELSKISKAYFEKQKEENRKKALKNVNMKQSLNYDLKHYSNS
FPSIESGKENNLIHNTEIEDFNGRGHSTNNHSSSYLSNSHSHPVSTQFVESANIELEKPT
LKKSLSNADSYRHTQREALQNIDVNSNVRDGAIDYKRQKIALKDSEFDGILDKKKYRGIK
RVEIVEPPTSTRPPSRKNVVSVNGTEYERVELLGRGGSSNVYKVRGLKNRVYALKKVSFD
EFDESSVEGFKGEISLLKQLQNQNRVVQLYDFEMGSGVLYLLMECGDYDLSQVLHQRANQ
PFDMEFIRYHAREMVTCVKVVHDAGIVHSDLKPANFVFVKGILKIIDFGIANAVPDHTVN
IYRDMQIGTPNYMAPEALVANNYTADNDGKYDQKTNKWKIGKPADIWSCGCIIYQMIYGK
PPYAKYQGQERLLSIMDPNVKIEYKEVLPDKTVIPSLALELMQYCLMRNPEERWSALQIL
DSPFLNPLMVSQDFIKNLITTAVSYGAREGDVSPSRLEALTDSVLARLADFRMH
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atggggaatccatatcacagtgaatcagatcaaatatggcgcatctcaagtcaagattct
gatgatggagagatcgggaacccacctaaactgagtaattttggttcagaacttatatct
gatgcaatagagaatatcaatcccaaccggtcagataagaaactgatatctgaagagaca
cgaatacacgagtctcacagtcagcaactgaatactgatataaaccagtccactagagtt
acgcatagtgcaagtagcccattatactttgaggacacgtctccatcaacaatgtttgtg
caatctcaagcttctgcgcaaccaagtgccacaacatatgatatcagctcgcaggattat
tcggattcaagtaagagttttataaaactcaaatcaaaacaggatactttgaagcaagaa
cttactaccagatatagtgaaagaaggacaagacgatttttgcatgctacaaatagaact
acaaaactgggaccagctctaaggaacttaacatcgccagccttggctataaatgataat
aattcaatagataacaagatgaatgaaactagcaaagtgaactctagctttgataccaac
aatgcatatgtggattttcatcagactaaacaagacatatatacatctggagaagagcac
aataatacgaaggataatggaaaaataggagcaacacaacagaatgattactccgacata
aatattcatgaatgcaatcccattcaatatatgaagatgcataacttgcccactagtgaa
ctttctaaaatttcaaaggcatattttgaaaagcagaaagaggaaaacagaaaaaaagcc
ttaaaaaatgtgaatatgaagcaatctttaaattacgacctgaaacactactctaactct
tttcctagcatcgaatccggcaaggagaataacctaattcataacactgagattgaggat
tttaatggaagaggacattcaacaaacaaccatagcagctcatatttaagtaactcacac
tcacatccagtatcgactcaatttgtcgaatcagcaaatatagaactcgagaaacctaca
cttaaaaagagtttaagcaatgctgattcatatagacatacacagagagaagctttacaa
aatatagatgttaactcaaatgtaagggatggtgctattgactataaaagacaaaaaata
gcattaaaagatagcgaattcgatgggatattggacaagaaaaaatatcgaggtataaaa
agagttgaaattgtcgaaccaccaacttctacacgtccccctagccgcaaaaatgtggtc
agtgtaaatggtaccgaatatgaacgtgtcgaacttttaggacggggtggttcatctaac
gtatataaggtacgaggtctcaagaatagggtttacgctttgaaaaaggtatcctttgat
gaatttgatgaatccagtgtagaaggttttaaaggtgagatcagcttattgaaacaatta
cagaaccagaatagagttgttcaattatatgatttcgagatgggttccggtgttttatat
ctcttgatggagtgtggtgattatgacctctctcaagtgctccatcaaagggccaatcaa
ccatttgacatggagtttataagatatcatgcaagagaaatggtcacttgtgtaaaagta
gtgcacgatgcaggcattgtgcattcggatctaaaaccggcaaattttgtttttgttaag
ggtatattaaaaattattgattttggtattgccaacgctgttccagaccacactgttaac
atttacagagatatgcaaattggtacaccaaactatatggcaccagaggcgcttgttgct
aacaactatactgcagacaatgacggcaaatatgatcaaaagacaaataaatggaaaatt
ggtaaacctgcagatatttggtcgtgcggatgtattatatatcaaatgatctatggtaaa
ccaccatacgccaaatatcagggacaggagagactactctccataatggatccaaatgtc
aaaattgaatataaagaagttctccccgataaaactgtaatcccgagcttggctttagag
ctgatgcaatactgcctaatgagaaaccctgaagaaagatggtctgcattgcagattctc
gactcaccatttttaaacccattgatggtatcgcaagatttcatcaagaatttgataact
actgcagtatcttatggtgctagagaaggtgatgtctctccatcaaggttagaggcgctt
actgatagcgttctcgcaagactagctgattttagaatgcattga

DBGET integrated database retrieval system