KEGG   Candida glabrata: CAGL0K01705gHelp
Entry
CAGL0K01705g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cgr  Candida glabrata
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CAGL0K01705g
   01230 Biosynthesis of amino acids
    CAGL0K01705g
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAGL0K01705g
  Energy metabolism
   00680 Methane metabolism
    CAGL0K01705g
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CAGL0K01705g
Enzymes [BR:cgr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CAGL0K01705g
Exosome [BR:cgr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CAGL0K01705g
  Exosomal proteins of melanoma cells
   CAGL0K01705g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
K:151967..152926
Genome map
AA seq 319 aa AA seqDB search
MSTLKLFILRHGQSDLNHENIFCGWIDAKLTDKGRSQAKNAGQLIAQHCKSNGITLPQIG
FTSRLLRTEQTMDVILNELQLGKKDEVSGQFNNPVFVVFDYIYTLAEIRSYLLSEKEENP
ISNEIPVLRTWRLNERHYGAWQGQRKPKVLKEYGEEQYMYIRRDYNGRPPEVDLEKEMIQ
KHDLGAATGYEFKEPNRSLKYELEELNQNIKLPYSESLSDVVARLEPFLDEIILKVAKEF
DLDSCLIVGHGSSVRSLLKILEGVSDEDIKGVDIPNGIPLVIELDKTNNFKFLRKYYLDP
ELAKINAEKVRKEGFEENP
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgctaaagttgtttatattgaggcatgggcagagtgatttgaaccatgagaat
atcttttgtgggtggattgatgctaaattgaccgataaagggcgttcccaggccaagaat
gctggtcaattgattgctcagcattgtaagagcaatggtattacgttgcctcagatcggt
tttacttccagactgctcagaaccgagcaaactatggatgttatcctcaatgagctgcaa
ttggggaagaaagacgaggtaagtggtcaattcaataatcccgtgtttgtggtatttgac
tatatctatacattggctgagataagaagctatctgttgagtgagaaggaagagaaccct
ataagtaatgaaatccctgtattgaggacatggaggctcaatgaaagacactacggtgct
tggcaggggcaaagaaagccaaaagtcttgaaagaatatggtgaagaacagtacatgtac
attcgaagagactataacggcaggccaccagaagttgatctcgagaaagagatgattcag
aaacatgacttaggtgctgccactggttatgagttcaaagaacccaacaggtcattgaaa
tacgagttagaagaactaaaccagaatattaagctaccgtactcagagtccctttctgat
gtggtggctagattagaacctttccttgacgagattatcttgaaagtggctaaagaattt
gatcttgactcctgtctaattgttggtcacggtagctctgttagatccctgttgaaaatt
ctcgaaggtgtttctgatgaagatatcaaaggagttgacattccaaatggtattccattg
gttatagaattggacaagacgaacaacttcaagtttttaagaaaatactacctggaccct
gagcttgctaagatcaatgctgaaaaagtgcgtaaggaaggttttgaagaaaacccttag

DBGET integrated database retrieval system