KEGG   Candida glabrata: CAGL0K01705gHelp
Entry
CAGL0K01705g      CDS       T01024                                 

Definition
(RefSeq) hypothetical protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cgr  Candida glabrata
Pathway
cgr00010  Glycolysis / Gluconeogenesis
cgr00260  Glycine, serine and threonine metabolism
cgr00680  Methane metabolism
cgr01100  Metabolic pathways
cgr01110  Biosynthesis of secondary metabolites
cgr01130  Biosynthesis of antibiotics
cgr01200  Carbon metabolism
cgr01230  Biosynthesis of amino acids
Module
cgr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cgr_M00002  Glycolysis, core module involving three-carbon compounds
cgr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAGL0K01705g
  Energy metabolism
   00680 Methane metabolism
    CAGL0K01705g
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CAGL0K01705g
Enzymes [BR:cgr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CAGL0K01705g
Membrane trafficking [BR:cgr04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CAGL0K01705g
Exosome [BR:cgr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CAGL0K01705g
  Exosomal proteins of melanoma cells
   CAGL0K01705g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 2890025
NCBI-ProteinID: XP_448299
UniProt: Q6FN95
Position
K:151967..152926
Genome map
AA seq 319 aa AA seqDB search
MSTLKLFILRHGQSDLNHENIFCGWIDAKLTDKGRSQAKNAGQLIAQHCKSNGITLPQIG
FTSRLLRTEQTMDVILNELQLGKKDEVSGQFNNPVFVVFDYIYTLAEIRSYLLSEKEENP
ISNEIPVLRTWRLNERHYGAWQGQRKPKVLKEYGEEQYMYIRRDYNGRPPEVDLEKEMIQ
KHDLGAATGYEFKEPNRSLKYELEELNQNIKLPYSESLSDVVARLEPFLDEIILKVAKEF
DLDSCLIVGHGSSVRSLLKILEGVSDEDIKGVDIPNGIPLVIELDKTNNFKFLRKYYLDP
ELAKINAEKVRKEGFEENP
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgctaaagttgtttatattgaggcatgggcagagtgatttgaaccatgagaat
atcttttgtgggtggattgatgctaaattgaccgataaagggcgttcccaggccaagaat
gctggtcaattgattgctcagcattgtaagagcaatggtattacgttgcctcagatcggt
tttacttccagactgctcagaaccgagcaaactatggatgttatcctcaatgagctgcaa
ttggggaagaaagacgaggtaagtggtcaattcaataatcccgtgtttgtggtatttgac
tatatctatacattggctgagataagaagctatctgttgagtgagaaggaagagaaccct
ataagtaatgaaatccctgtattgaggacatggaggctcaatgaaagacactacggtgct
tggcaggggcaaagaaagccaaaagtcttgaaagaatatggtgaagaacagtacatgtac
attcgaagagactataacggcaggccaccagaagttgatctcgagaaagagatgattcag
aaacatgacttaggtgctgccactggttatgagttcaaagaacccaacaggtcattgaaa
tacgagttagaagaactaaaccagaatattaagctaccgtactcagagtccctttctgat
gtggtggctagattagaacctttccttgacgagattatcttgaaagtggctaaagaattt
gatcttgactcctgtctaattgttggtcacggtagctctgttagatccctgttgaaaatt
ctcgaaggtgtttctgatgaagatatcaaaggagttgacattccaaatggtattccattg
gttatagaattggacaagacgaacaacttcaagtttttaagaaaatactacctggaccct
gagcttgctaagatcaatgctgaaaaagtgcgtaaggaaggttttgaagaaaacccttag

DBGET integrated database retrieval system