KEGG   Candida glabrata: CAGL0K02079gHelp
Entry
CAGL0K02079g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
cgr  Candida glabrata
Pathway
mRNA surveillance pathway
Meiosis - yeast
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:cgr03015]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:cgr04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
K:179166..180104
Genome map
AA seq 312 aa AA seqDB search
MESQQVDVDSIIDRLLEVRGSKPGQQVDLEEHEIRHLCSKARSIFIKQPILLELEAPIKI
CGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFIL
RGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCMHGGLSPDLN
SMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDIVGWSENDRGVSFTFGPDVVNRFLQKQDM
ELICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAQK
SLPRQQAGRKKK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggaatcccagcaagttgatgtggatagtattattgataggttgttggaagtgaggggt
tctaagcctgggcagcaagttgatcttgaggagcatgagatcagacatctgtgctcgaag
gcgcggtctatattcatcaagcagccgattctgctggagctagaggctcctatcaagatc
tgtggtgatatccacgggcagtactatgatctacttcgtctgtttgagtatggtgggttc
ccacctgagtccaactacttgtttctaggtgactatgtcgaccgtggtaagcaatcactt
gagaccatatgtttattgctggcatacaagatcaaatacccagagaacttcttcatcttg
agaggtaaccacgagtgtgcatccattaatagaatctacggtttttacgatgagtgtaag
agacgttataacatcaagttgtggaagacattcacagactgtttcaactgtttgcctatt
gcagccattatcgacgagaagatcttctgtatgcacggtggtctatccccagacttgaac
agcatggaacagatcagaagagtaatgagaccaaccgatatcccagatgtcggcttgcta
tgtgatttattgtggtcagatccagataaggatattgtaggttggagtgaaaacgataga
ggtgtctcatttactttcggtccggacgtcgtgaatagattcttacagaaacaagatatg
gaactgatctgtagggcacatcaagtcgtggaagatggttacgaattcttcagtaaaaga
caactggttaccctgtttagtgcaccaaattactgtggtgagttcgataacgccggtgcc
atgatgagtgttgatgagagtttattatgttcattccaaatcctaaagcctgctcaaaag
agtttgccaagacaacaagccggtagaaagaagaaatag

DBGET integrated database retrieval system