KEGG   Candida glabrata: CAGL0K03289gHelp
Entry
CAGL0K03289g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
cgr  Candida glabrata
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAGL0K03289g
Enzymes [BR:cgr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     CAGL0K03289g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
K:301825..302718
Genome map
AA seq 297 aa AA seqDB search
MSIEETDSQVVITHPSNSNTSVTILKYGATVTSWKLNGEEQLWLSTAAKLDGSKPVRGGI
PLVFPVFGKNQSDELLSKLPQHGFARNSTWEFLGQVKSNPPTVQFGLNPKIANQELVKLW
PLDFNLILTIELGEDFLKTAIEVENASEENMKFNWLFHTYLHIEDIEDTMVSNLVGMKVY
DQLLKESFIDKHPVVTFHQETDSIYQNVDSDRLIQVVGKGKPLHTVKRENLPDAVVWNPW
VDKSAGMGDFEPKDGFKNMVCVEPGHVSDFVVLPPGQKWSAAQILSKQELNYQAIEP
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtctattgaagaaactgactcccaagttgtgatcactcatccatctaactctaatact
tcagtcaccatccttaagtatggtgccactgttacttcatggaaattgaatggtgaagaa
caattgtggctatccaccgctgccaaattggatggttccaagccagttagaggtggtatt
ccattggtgttcccagtttttggtaagaaccaaagtgacgaacttttgagcaagcttcca
caacatggttttgcaagaaactctacatgggagttcctgggccaagttaagagtaaccca
ccaactgttcaatttggattgaatccaaagattgccaaccaggaattggttaagctatgg
cctttagatttcaacttgattttgaccatagaacttggtgaggacttcttgaaaactgcc
attgaagttgagaatgcttctgaggagaacatgaaattcaactggctattccacacctac
ttacacatcgaagacattgaggacaccatggtctccaacttagttggtatgaaggtctac
gaccaattgctaaaggagagcttcattgacaagcaccctgtggttactttccaccaagaa
acagactctatttaccagaacgtcgattccgatagattgatccaagttgtaggtaagggt
aagccactacatactgtcaagagggaaaatctaccagacgctgtcgtttggaacccatgg
gtcgacaaatccgcaggtatgggcgacttcgaaccaaaggatggtttcaagaacatggtc
tgtgttgagccaggccatgtcagtgacttcgttgtcttgccaccaggtcaaaaatggtct
gctgctcaaatcttgtccaagcaagaattgaactaccaagccatcgaaccataa

DBGET integrated database retrieval system