KEGG   Candida glabrata: CAGL0K03773gHelp
Entry
CAGL0K03773g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K11401  
histone acetyltransferase SAS2 [EC:2.3.1.48]
Organism
cgr  Candida glabrata
Brite
Enzymes [BR:cgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CAGL0K03773g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
K:complement(348963..350024)
Genome map
AA seq 353 aa AA seqDB search
MNVEENDDLYGILAEKNIKFVQLGLFKKFETWYGTAVYFNSENKKLGFYDETQMKPGQQG
NGYGRGSKIIKGKTVKKKKMTNKALSSLNDHALSNIQLKSNPKTSDNQFWLDTLYVCEYC
FKYTDVKDDFVNHVHQCSFKEKAPGRIKYKSPQYTIRRVKGSKHQLFCQCLCLFTKLYLD
NKSVFFKLDHYEFYIVYETGKTIPMAFFSKDLVSYNQNNLACILTLPPYQRMGLGSLLIE
FSYHLSRLEGIVSGPELPLSPFGLIGYLRYWSLVICWQLCEGDLSNFERLSIQDISLATG
IRISDIIPTLKHLNCIIDENHINLKVLKQWLKTHTKPGQNPFMINEEYLLIDD
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtggaagagaacgatgatttgtatggtattttagccgagaagaacatcaagttc
gttcaattagggttgttcaagaagtttgagacttggtatggtaccgctgtgtatttcaac
agcgagaacaagaagcttgggttttatgatgagactcagatgaagccaggtcagcaaggc
aatggctatggtagaggttcaaagatcatcaagggcaaaactgtcaagaaaaagaagatg
actaacaaagctttgagctcattgaatgatcatgcgttatccaacattcagcttaagagc
aatccaaagacctcggataatcaattttggttagatactctctatgtgtgtgaatattgc
tttaaatacaccgatgtgaaagacgattttgtaaatcatgttcaccaatgttctttcaag
gagaaggcacccgggaggatcaaatataaaagtccccaatacacgatacgccgggtaaag
ggctctaaacaccaactgttctgtcaatgtctctgtcttttcactaaattatacttggat
aacaaatctgttttctttaagctagatcactatgagttttacatagtctatgagactgga
aaaaccatccccatggcatttttctcaaaggatctagtgtcttataaccagaacaaccta
gcatgcatcttgactcttcctccatatcagagaatgggcctgggctctctacttatagaa
ttctcgtaccatttatcccgcctagaaggtatagtatctggacctgagcttcctttgtca
ccatttggtcttatagggtatctgcgatattggtcactagtgatctgctggcagctttgc
gaaggcgacctatctaactttgaaagattgtcaatacaggacatatctttagccacaggg
ataagaataagtgacatcataccgaccctgaaacacttgaactgcattatagatgaaaac
cacataaaccttaaagtactaaagcagtggcttaaaacgcatactaaaccagggcaaaac
ccattcatgattaatgaagaatatctactgatagacgattga

DBGET integrated database retrieval system