KEGG   Candida glabrata: CAGL0K04169gHelp
Entry
CAGL0K04169g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
cgr  Candida glabrata
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
K:384567..385763
Genome map
AA seq 398 aa AA seqDB search
MPRTITFNIPKEYKLVDLVGEGSYGIVCSATHLPTGNKVAIKRIRFPDSPPSDDGQGVPR
LEEDDEHDNIAKVALIRTIREIKILSHFNNHENIITIFEKIKPMQSINFKEIYLVQELME
TDLSRILASSNTLTVDHIQYFLYQILRALKAIHSAKVIHRDLKPSNILLNSNCDLKICDF
GLARTYDPDDDASTMNGNNVGFLTEYVATRWYRAPEIMLNFQDYSTAIDIWSCGCVLAEM
LFRKPIFPGKDYHHQLLLILDTLGTPSPEDIEAINYGRAKEYILSLPHFPKKDWSQLLGT
DNEMLLDILDKLMIFNPKRRITAEQALEHPFLATYHDPKDEPNFPPLNFKGDEFWQLDNC
METSNGYGTDDSNNLRANVTRRKLREILYQEMVTPAPR
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgccaagaactattacatttaatatcccaaaggagtataaacttgtggaccttgttggt
gaaggttcctacggtatagtctgttcggcgactcatttgcccacgggcaacaaagtagcc
atcaagagaataaggttcccggactcaccgccttctgatgatgggcaaggtgtgccacga
ttagaggaagacgatgagcatgataacattgccaaagtcgcgttgatcaggactatcaga
gagatcaaaatcctatcgcattttaataaccatgagaacatcatcacgatatttgagaag
atcaaacctatgcagtcgataaacttcaaagagatttatttagtacaggagttaatggaa
acagatctgtcgagaattttagcatcgtcaaatactttgactgtggatcatattcaatat
ttcttataccagatacttcgggcactgaaagccattcattctgctaaagttatacacaga
gacttaaaaccttctaatattttactgaactcgaactgtgatttaaagatatgtgatttt
ggtctagcaaggacgtatgaccccgatgatgatgcctcaacgatgaacggtaacaacgtt
ggattcctgactgagtatgtagcaaccagatggtacagagcaccagaaataatgctcaat
tttcaggattactctactgctatcgatatttggtcatgtggttgtgtactagcagaaatg
ctattccgtaagccaatattcccgggtaaagactatcaccatcaactacttttgattttg
gacaccttgggaacccctagtcccgaggatatcgaagctattaattatggtagagcaaag
gagtatattctaagtctgcctcattttccaaagaaggactggtcacaactgcttgggaca
gataatgagatgttacttgatatactagacaagttaatgattttcaatccaaagagaagg
ataactgcagagcaggctcttgaacatcctttcttagcaacataccacgatcctaaagat
gagcccaactttccacctcttaactttaaaggagatgaattctggcaacttgataattgc
atggagaccagcaatggatatgggacagacgacagcaataacctaagagccaacgtgact
agaagaaagttgagagagatactataccaagaaatggtcactccagcgcctaggtga

DBGET integrated database retrieval system