KEGG   Candida glabrata: CAGL0K05115gHelp
Entry
CAGL0K05115g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
cgr  Candida glabrata
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    CAGL0K05115g
  Replication and repair
   03420 Nucleotide excision repair
    CAGL0K05115g
Transcription machinery [BR:cgr03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CAGL0K05115g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
K:complement(498091..499194)
Genome map
AA seq 367 aa AA seqDB search
MSESGVSTQSPQNSSTPDAKPVEHPPNYKRLTDDDLYRHSSQFRLWSFTPDKLLQKRTET
NARAVVVIEEKLRAFKEKHKDELTPDVAKVIDSKATPITTEEELKLVNFYAQKVQVIAQK
MSLPTEVVATSISFFRRFFLENSVLEVEPKDIVHTTIFLACKSENYFISVNSFAEKAKAT
KETILKYEFKLLETLKFTLMNHHPYKPLHGFFLDIQKTLHGKIDLKYMGKIYEKCKKRIT
EALLTDAVYFYTPPQITLATLMIEDEALTTRYLELKFHGQDAQTTDNTTDKSHSIHHINF
ERLLSVVQSCKEILEKPITISVQEAKGIMAKIYYCENPEGLLNRLKREPPKDSEDSPAKK
QKVLPPQ
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagtctggtgtgtctacgcagagtccacaaaattcttcaacgcctgatgcgaag
ccagttgagcatccacctaattacaagaggttaactgatgatgatctatatagacactcc
tcacaattcaggttatggtcgtttacacctgacaagttgttacagaaacgtacagagacg
aatgctagggctgtggttgttatagaagagaagcttagggcattcaaggagaaacacaag
gatgagttaacgcctgatgtagcgaaagtgatagatagcaaagccacaccgattaccacg
gaggaagaactcaaactggtaaacttctatgcgcaaaaagtacaagtcattgctcagaag
atgagcttacccactgaagtggtagccacctcaatttcattttttaggagattctttttg
gaaaactcagtattagaggttgagccaaaggacattgtacataccacaatttttctggct
tgcaaatcagagaactatttcataagtgtgaattcatttgcggagaaggcaaaggcaaca
aaggagaccatactgaaatatgaattcaaactcttagaaacgctaaagttcacgttaatg
aaccaccacccatataaaccattacatggtttctttttagatatccagaagacgttacat
ggcaagatcgacttgaagtacatgggtaagatttacgaaaaatgtaagaagagaataacg
gaagctctactgactgatgctgtttatttctatactccaccacaaataacgttagcaact
ctaatgatagaagatgaggctttaacaacaagatacttagaactgaaattccatggacag
gacgctcaaacgactgataatactactgacaagtctcacagcattcatcacattaatttt
gagaggctcttaagtgtagttcaatcatgtaaggaaatcctggagaaaccaattactatt
agcgtgcaggaggcaaagggaattatggcaaagatatactactgtgaaaacccagaaggg
ctactaaacaggttgaaacgagaaccacccaaggattcggaagattcaccagcaaaaaag
caaaaggtgttgccgccccagtga

DBGET integrated database retrieval system