KEGG   Candida glabrata: CAGL0K05511gHelp
Entry
CAGL0K05511g      CDS       T01024                                 

Definition
(RefSeq) hypothetical protein
  KO
K12595  superkiller protein 7
Organism
cgr  Candida glabrata
Pathway
cgr03015  mRNA surveillance pathway
cgr03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    CAGL0K05511g
  Folding, sorting and degradation
   03018 RNA degradation
    CAGL0K05511g
Messenger RNA biogenesis [BR:cgr03019]
 Eukaryotic Type
  mRNA degradation factors
   3'-5' decay
    Exosome cofactors
     CAGL0K05511g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_18 AAA_33 SUV3_C cobW AAA_17
Motif
Other DBs
NCBI-GeneID: 2890489
NCBI-ProteinID: XP_448465
UniProt: Q6FMS9
Position
K:complement(539944..542127)
Genome map
AA seq 727 aa AA seqDB search
MSRLEELARQRRLKKAGSESSESSKNYEGTSKSASLLEKLRNRKKTASESPHNSEANTEI
ANHGSQAALNQTSGKVRSTPIKTSSSSTLGSKLRELRSRKKVEEAKQKESVDVTPEIDSL
PNGQSNKQSRDQLKQQYLVEMAEFKALQGRLNINIDSSKTIRRLSGHSKFLVNSRNKVHK
LYKQKRDMLLTVFYPARNKSARKKSIEGFHKPSPDDIVLAAQEQVFQAVTENVAQLSIKP
IKIKERVSKRFTDNMTDQTKVQKQQLTVEDFINDRNATSFQVPMFGLPGSGKSTILGQLS
FHLGLTTREDIRVIKTDMERMHFRRIDKLDTRLLTTSPFCWVVDETTEERQFGHSNNIKP
LHIKYNDTDIIINEVPGSFDLCSTIETKRYVGNSVIIVVSAELGDYEANFDMKKRLIEKL
IYCNGVGVRRILTIINKMDLIDWDMDRYTVMKHELELIYQQVGIDILKCDFIGTSAITGE
ALTNDGDNRKRMFTKGSFSSLLNVLLSYKLQFKKEVLESSLVNSQEQTLLDSEKLIAIQT
GNKHEQQLSVPFYIERGLILKGQKLKINRTGLEVVVKSIKESLRKKKSVNVAVVGQSVDL
LFEPSEAITSSNINNILTSCNSPKLIETSEFNMKMWSLKNCSKQLDFNNILIFCVGRFLN
ICISNVEQTENNEKLNNFQYIFCRACLKSSENMLAFEPGYESAKSFVLFFENRAIGFGEL
LLNDRSF
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagattggaagaattggcccgacagcgaaggttaaagaaagctggtagtgagtct
agtgaatcttcaaagaattatgaaggaaccagcaaaagtgcaagtctattggaaaaatta
cggaacagaaagaaaacagcttccgaaagtccacataactcagaggcaaatactgaaata
gcgaatcatggatcacaagcggcgttgaatcaaaccagtggtaaggttagaagcacaccc
ataaaaacatctagcagctctacattaggatcaaaattgagagaacttaggagcagaaag
aaagtagaggaagctaaacaaaaagaatctgttgatgtgacacctgaaatagatagttta
ccaaacgggcaatcaaataagcaatcgcgggatcaactgaaacagcaatatttagttgag
atggcagagttcaaagctcttcaggggcggttgaatataaatatagactcgagcaagacg
atacgaagactgagtggccattctaaatttctcgttaattcacgaaacaaagttcacaaa
ctttacaaacagaagagagatatgttattaactgtattttatccagccagaaataagtct
gccagaaaaaagagtattgaaggcttccataaacccagtccggatgatattgttctagcc
gctcaagagcaagtattccaagcggtgactgaaaatgttgcacaattatccataaaaccc
ataaaaatcaaagaaagagtaagtaaacgattcactgataatatgactgatcagactaag
gtgcagaaacagcaacttacggtagaagattttattaatgatcgtaatgctacttcattt
caagtaccgatgttcggactaccaggtagtggtaaatctaccattttaggacaattatca
tttcacctaggactaacaacacgagaggacattagagttatcaagacagacatggaacgt
atgcactttcgaaggattgataagttggataccagattgctgacaacttcacctttttgt
tgggttgttgatgaaacgacagaggaaaggcagtttggacattccaacaatatcaaacct
ctgcatataaaatataatgacacggatataataataaatgaggtaccaggcagttttgat
ctttgctctactattgaaacaaaaagatatgtgggaaattctgtaataattgtcgtcagt
gcagaattgggtgactatgaagcaaattttgacatgaaaaagcggttaattgaaaagttg
atttactgcaatggagtcggtgttaggagaattctgactataattaataaaatggatcta
attgattgggatatggacagatatacagttatgaaacatgaattagaactaatatatcag
caagtgggtatcgacattctgaaatgtgattttattgggactagtgcaattacaggagaa
gcgttaactaacgatggcgataatcggaaaagaatgttcacaaaaggcagtttctcatca
ttgttgaatgttctgttatcgtataaattgcaattcaaaaaagaagttttggaatcaagc
ctagtgaatagccaagaacaaacgctattagacagcgaaaaattaatagctatacaaaca
ggaaataagcatgaacagcaattgtctgtacctttttatattgaaagaggtttgatattg
aaaggtcaaaaactcaagataaatagaactgggttagaggtagtagttaagagcattaaa
gagtcactcagaaagaaaaaatcagttaatgtagcagttgttgggcaatcagttgatttg
ctttttgaaccatcagaggcaataacaagtagcaatatcaacaatattctaacttcctgt
aattcacctaagttaattgagacttcagagtttaacatgaagatgtggtctctgaaaaat
tgttctaagcaactggattttaataacatattaattttctgtgttggaaggttcctcaac
atctgtatttcaaatgtagaacaaacagaaaataatgagaaattgaataactttcaatac
atattctgtcgagcatgtctaaaaagtagtgagaacatgcttgcatttgagcctggttat
gaatctgccaaatcttttgtgctattctttgaaaatagggctattggatttggggaattg
ctgctgaatgatcgcagtttttga

DBGET integrated database retrieval system