KEGG   Candida glabrata: CAGL0K05511gHelp
Entry
CAGL0K05511g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K12595  
superkiller protein 7
Organism
cgr  Candida glabrata
Pathway
mRNA surveillance pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    CAGL0K05511g
  Folding, sorting and degradation
   03018 RNA degradation
    CAGL0K05511g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
K:complement(539944..542127)
Genome map
AA seq 727 aa AA seqDB search
MSRLEELARQRRLKKAGSESSESSKNYEGTSKSASLLEKLRNRKKTASESPHNSEANTEI
ANHGSQAALNQTSGKVRSTPIKTSSSSTLGSKLRELRSRKKVEEAKQKESVDVTPEIDSL
PNGQSNKQSRDQLKQQYLVEMAEFKALQGRLNINIDSSKTIRRLSGHSKFLVNSRNKVHK
LYKQKRDMLLTVFYPARNKSARKKSIEGFHKPSPDDIVLAAQEQVFQAVTENVAQLSIKP
IKIKERVSKRFTDNMTDQTKVQKQQLTVEDFINDRNATSFQVPMFGLPGSGKSTILGQLS
FHLGLTTREDIRVIKTDMERMHFRRIDKLDTRLLTTSPFCWVVDETTEERQFGHSNNIKP
LHIKYNDTDIIINEVPGSFDLCSTIETKRYVGNSVIIVVSAELGDYEANFDMKKRLIEKL
IYCNGVGVRRILTIINKMDLIDWDMDRYTVMKHELELIYQQVGIDILKCDFIGTSAITGE
ALTNDGDNRKRMFTKGSFSSLLNVLLSYKLQFKKEVLESSLVNSQEQTLLDSEKLIAIQT
GNKHEQQLSVPFYIERGLILKGQKLKINRTGLEVVVKSIKESLRKKKSVNVAVVGQSVDL
LFEPSEAITSSNINNILTSCNSPKLIETSEFNMKMWSLKNCSKQLDFNNILIFCVGRFLN
ICISNVEQTENNEKLNNFQYIFCRACLKSSENMLAFEPGYESAKSFVLFFENRAIGFGEL
LLNDRSF
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagattggaagaattggcccgacagcgaaggttaaagaaagctggtagtgagtct
agtgaatcttcaaagaattatgaaggaaccagcaaaagtgcaagtctattggaaaaatta
cggaacagaaagaaaacagcttccgaaagtccacataactcagaggcaaatactgaaata
gcgaatcatggatcacaagcggcgttgaatcaaaccagtggtaaggttagaagcacaccc
ataaaaacatctagcagctctacattaggatcaaaattgagagaacttaggagcagaaag
aaagtagaggaagctaaacaaaaagaatctgttgatgtgacacctgaaatagatagttta
ccaaacgggcaatcaaataagcaatcgcgggatcaactgaaacagcaatatttagttgag
atggcagagttcaaagctcttcaggggcggttgaatataaatatagactcgagcaagacg
atacgaagactgagtggccattctaaatttctcgttaattcacgaaacaaagttcacaaa
ctttacaaacagaagagagatatgttattaactgtattttatccagccagaaataagtct
gccagaaaaaagagtattgaaggcttccataaacccagtccggatgatattgttctagcc
gctcaagagcaagtattccaagcggtgactgaaaatgttgcacaattatccataaaaccc
ataaaaatcaaagaaagagtaagtaaacgattcactgataatatgactgatcagactaag
gtgcagaaacagcaacttacggtagaagattttattaatgatcgtaatgctacttcattt
caagtaccgatgttcggactaccaggtagtggtaaatctaccattttaggacaattatca
tttcacctaggactaacaacacgagaggacattagagttatcaagacagacatggaacgt
atgcactttcgaaggattgataagttggataccagattgctgacaacttcacctttttgt
tgggttgttgatgaaacgacagaggaaaggcagtttggacattccaacaatatcaaacct
ctgcatataaaatataatgacacggatataataataaatgaggtaccaggcagttttgat
ctttgctctactattgaaacaaaaagatatgtgggaaattctgtaataattgtcgtcagt
gcagaattgggtgactatgaagcaaattttgacatgaaaaagcggttaattgaaaagttg
atttactgcaatggagtcggtgttaggagaattctgactataattaataaaatggatcta
attgattgggatatggacagatatacagttatgaaacatgaattagaactaatatatcag
caagtgggtatcgacattctgaaatgtgattttattgggactagtgcaattacaggagaa
gcgttaactaacgatggcgataatcggaaaagaatgttcacaaaaggcagtttctcatca
ttgttgaatgttctgttatcgtataaattgcaattcaaaaaagaagttttggaatcaagc
ctagtgaatagccaagaacaaacgctattagacagcgaaaaattaatagctatacaaaca
ggaaataagcatgaacagcaattgtctgtacctttttatattgaaagaggtttgatattg
aaaggtcaaaaactcaagataaatagaactgggttagaggtagtagttaagagcattaaa
gagtcactcagaaagaaaaaatcagttaatgtagcagttgttgggcaatcagttgatttg
ctttttgaaccatcagaggcaataacaagtagcaatatcaacaatattctaacttcctgt
aattcacctaagttaattgagacttcagagtttaacatgaagatgtggtctctgaaaaat
tgttctaagcaactggattttaataacatattaattttctgtgttggaaggttcctcaac
atctgtatttcaaatgtagaacaaacagaaaataatgagaaattgaataactttcaatac
atattctgtcgagcatgtctaaaaagtagtgagaacatgcttgcatttgagcctggttat
gaatctgccaaatcttttgtgctattctttgaaaatagggctattggatttggggaattg
ctgctgaatgatcgcagtttttga

DBGET integrated database retrieval system