KEGG   Candida glabrata: CAGL0K05995gHelp
Entry
CAGL0K05995g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
cgr  Candida glabrata
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CAGL0K05995g
Enzymes [BR:cgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     CAGL0K05995g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
K:583945..586329
Genome map
AA seq 794 aa AA seqDB search
MIAKNRVDDDVYVTMKSKKKSKNSGRSQSVPISKNKRMISRGQLVEDGVRIVGVTSLNTF
QNKAPANMRSTTTNVYRPSTMMFSNDSSYSMGVGGRQYGDESKEGPRLSIESRISSTDSF
ISANSYVRRSNSSVFETASLVSCVTCLSDSSYSTSSGSSSLSLASSATGNSQKMRHRKKN
HSGNDDTNNKLDTFLPINTVIPYARIINAKIFTTTPQNQNQEPRTSNDFTNQSILSRDDV
SSQASKFISVPDDRPRRKSFKRKPSNARITSMTSIDGDTDNNPFSTQPSSTSASASRTTT
NNDNNDNVDLKNPFNTNDDDNVNNSKVSVKESEILYEGSQDEMENIKSLHLIEITFAKPR
RQDVVPKKIVIAIETTELLRGPSEIVDAIMDRSYKGTKQSRSILAIINPFGGKGKAKKLF
MTKAKPLLSASRSTVEIKYTKYPQEAIDIAREMDISKYDTIVCASGDGIPYEVINGLYRR
PDRVEAFNKLAITQLPCGSGNAMSVSCHWTNNPSYAALCLLKSVEARIDLMCCSQPSYAD
EYPKLSFLSQTYGVIAESDINTEFIRWMGPARFELGVAFNVLQRKKYPCDLYVKYAAKSK
NDLKVHYLEHKNQGSLTFEGDLNEESPETEDTKQISKSNENEISNEITEDSFKLKYPLKD
GVPDDWERLDPSISNNIGIFYTGKMPYIAADTKFFPAALPSDGTIDMVVTDARTSVTRMA
PILLALDKGSHVLQPEVIHSKILAYKLIPKLNHGLFSVDGEKFPLEPLQVEVLPRLCKTL
LRNGSYVDTEFDTM
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atgatagctaagaatagagtagacgatgatgtgtatgtgaccatgaagagcaagaagaag
agcaagaatagcgggcggtctcagtccgttccgatttccaagaacaagcggatgatctcg
aggggtcaattagtggaggacggggtgcgcatagtcggggtgactagtctcaacactttc
cagaacaaggcacccgccaatatgcgcagcaccaccacgaacgtgtacagaccgagcacg
atgatgttcagcaatgactcctcgtatagcatgggtgtgggtggcagacagtacggcgac
gagtccaaggaaggccctagactgagcatagagagcaggataagctcaacagatagcttt
ataagtgcgaacagctacgtgagaaggtcgaactcgagtgtctttgagactgcctccttg
gtgagttgcgtcacttgtttaagcgactcgagctactcaaccagtagcggaagctcttca
ctgagcttagcgtcgtctgctacaggtaactcgcagaaaatgagacatcgcaagaagaac
cacagcggcaacgacgacactaacaacaaattggacactttcttacctataaacaccgtg
ataccttacgcaagaattatcaatgccaagatatttaccactacaccacaaaatcagaac
caagaaccaagaacctcgaacgatttcacaaaccagtccatactttcccgtgatgatgtg
tcctcacaggcgtctaaatttatctctgtacctgatgataggcccagaagaaaaagtttt
aagagaaaaccttccaacgctagaataacatcaatgaccagcatagacggtgacaccgat
aataacccgttcagcacccagccatcatcaacatcagcatcagcatcaagaacaactaca
aataacgacaataacgacaacgtggatctaaagaacccattcaatactaatgacgacgac
aatgttaataattcaaaagtttcagtaaaagagtcagaaatactctacgaaggcagtcaa
gatgaaatggaaaacataaaaagcttacatttaatagagataacttttgccaaacctaga
agacaagacgtggtacctaagaaaattgtgattgccatcgaaaccactgagctactaaga
ggtccatctgagattgtagatgccatcatggatagaagttataaaggcacaaaacaatcc
agatctatcctagccattattaacccatttggtggtaaaggtaaagctaaaaaactgttt
atgacaaaggccaaacctttgctgagcgccagtagaagtactgttgagatcaagtacaca
aagtatcctcaggaagccatcgatatcgccagagaaatggatatatctaaatatgacacc
attgtatgtgcctcaggtgatggtattccctatgaagtcattaacggtctttatagaagg
cctgatagagttgaagctttcaacaaactggctatcacacaactaccttgtggatcaggt
aacgccatgagtgtctcttgccattggacaaacaatccgtcttatgctgcattatgcctt
cttaaatcagtagaagctagaatcgacttgatgtgttgttctcaaccatcttacgctgat
gaatatcctaaattatcatttctaagtcagacttatggtgtgattgcagaatccgatatc
aacacagaatttattagatggatgggtccagccagatttgaacttggtgtcgcgttcaat
gtcttgcagagaaagaagtacccgtgtgacctttacgtcaagtacgctgcgaagtcaaaa
aatgacctaaaagtacactatctagaacataagaatcaaggctctcttacatttgaaggg
gacctaaacgaggaatctccagagactgaggacactaaacagatatcaaagtctaatgaa
aatgaaatctcaaatgaaatcactgaggacagtttcaaattgaagtaccctctaaaggac
ggcgttccagatgactgggagaggcttgatccatctatctcgaataatattggtatcttt
tacacgggtaaaatgccttatattgcagctgataccaaattctttccagctgcattgcca
tctgatggtaccattgatatggttgtcacagatgccagaacttccgttacaagaatggcg
cctatccttctagctttggataaaggatcccatgtcttacaaccagaagttattcactcc
aaaatcttagcatataaattgatcccaaaactaaatcacggactattttcagttgatggt
gaaaaattcccattggaacctttacaagttgaagtcctaccaagactttgtaagacctta
ctaagaaatggtagttatgtggatactgaattcgatactatgtaa

DBGET integrated database retrieval system