KEGG   Candida glabrata: CAGL0K06281gHelp
Entry
CAGL0K06281g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cgr  Candida glabrata
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cgr00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
K:complement(609816..610373)
Genome map
AA seq 185 aa AA seqDB search
MSRPIVISGPSGTGKSTLLKKLFAEFPDTFGFSVSSTTRSPRPGEVHGKDYNFVTVDEFK
SMIDGEKFIEWAQFSGNYYGTTVDSVKAVISSGKTCILDIDMQGVKAVKTKDLNARFLFV
APPSMDDLKARLQGRGTETDESLQKRLAAADAEMEYANSGAHDKIIVNDDLDKAYNELKQ
FIFEN
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtccaattgtcatctctggtccaagtggtactggtaagtccactctattaaag
aagctatttgctgaattcccagacactttcggtttcagtgtctcgtctacaacacgttct
ccaagaccaggtgaggtacatggcaaggactacaactttgtcactgttgatgagttcaaa
tcaatgatcgacggcgagaagttcatcgaatgggcccaattctctggtaactactatggt
actaccgtggactccgttaaggctgtcatcagttctggcaagacctgtatcctagatatc
gatatgcaaggtgtcaaagctgtcaagaccaaggaccttaacgctagatttttgttcgtt
gccccaccatccatggacgacctaaaggctaggttgcaaggcagaggtaccgagacagac
gaatccttacaaaagagactggccgctgctgatgcagagatggaatacgctaacagcggt
gctcacgacaaaatcattgtcaatgatgaccttgacaaggcttacaacgaattgaagcaa
ttcatcttcgagaactaa

DBGET integrated database retrieval system