KEGG   Candida glabrata: CAGL0K08184gHelp
Entry
CAGL0K08184g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cgr  Candida glabrata
Brite
Enzymes [BR:cgr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     CAGL0K08184g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
K:813815..814888
Genome map
AA seq 357 aa AA seqDB search
MSATALRIAPIASRTFQRRLGYLLAGVATGAAATVAYKAQKNNNYYKYNNNNNNNSGFKA
GALAAAAGVVHLAHEEDKKTADYQKVYNLIAERLRDDDEYDNYIGYGPVLVRLAWHSSGT
WDKNDNTGGSYGGTYRYKKESQDPSNAGLENAAKFLEPVKKQFPWISYGDLYTLGGVVGI
QELQGPKIPWRSGRTDLPEDMTPDNGRLPDGDKDANYVRNFYKRLDFNDREVVALLGAHA
LGKTHLKNSGFEGPWGAANNIFTNEFYLNLLNEDWKLEKNDAGNLQYNSPKGYMMLPTDY
ALIQDSNYLKIVKEYAADQDAFFRDFSKAFAALLERGIDFPKNQPVHIFKTLDEQGL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctactgcattgagaattgctccaattgcctccagaacattccaaagaaggttg
ggctacttgctggctggtgttgctaccggtgctgctgctactgttgcttataaggctcag
aagaacaacaactactacaaatacaacaacaacaataacaacaacagtggcttcaaggct
ggtgcactagctgctgctgctggtgttgttcacttagctcatgaagaagacaagaagact
gctgactaccagaaagtctacaatctgattgcagagagattgagagacgacgatgaatat
gacaactatattggttacggtccagtattggtcagattagcttggcactcttctggtacc
tgggacaagaacgacaacactggtggttcttatggtggtacttacagatacaagaaggaa
agccaggatccatccaatgctggtctagagaacgcagccaagttcttggaaccagtaaag
aagcaattcccatggatctcttatggtgacttgtataccttgggtggtgttgtaggtatt
caagagcttcaaggtcctaagatcccatggagatcaggtagaaccgatctgccagaagat
atgaccccagacaatggtagattaccagatggtgacaaggacgcaaactacgttagaaac
ttctacaagagattggattttaacgacagagaagttgtcgctctattgggtgcacatgct
ttgggtaagacacatttgaagaactctggttttgaaggcccatggggtgctgccaacaac
atcttcactaatgaattctacttgaacttgttgaacgaggactggaaactagaaaagaat
gatgccggtaacttgcaatataactctccaaagggttacatgatgttgccaaccgattac
gctttgatccaagactcaaactacttgaagattgtcaaggagtacgctgctgaccaagat
gctttcttcagagacttctctaaggcctttgctgctttgttagagagaggtattgatttc
ccaaagaaccaaccagttcacatcttcaagactttagatgaacaaggattgtaa

DBGET integrated database retrieval system