KEGG   Candida glabrata: CAGL0K08800gHelp
Entry
CAGL0K08800g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
cgr  Candida glabrata
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CAGL0K08800g
Enzymes [BR:cgr01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     CAGL0K08800g
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     CAGL0K08800g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
K:883874..884401
Genome map
AA seq 175 aa AA seqDB search
MVEIYVHDENDSVDFRQPHNSGKTVALEDLGKIGVIYKHIADQADVDILAKERNYKNRDI
VTINVDTFKGDKNALEKQLGIFYKEHLHEDEEIRYCIEGSGYFDVRNGKDDVWVRCKVGP
GDLLILPAGIYHRFTLTETNHIKALRLFKDEPKWQAYNRPDADSLPVRHEYLQSI
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggtggaaatatatgtacatgacgaaaacgacagtgtcgactttagacagccacacaac
agcggtaagactgtagctctagaggatcttggaaagattggtgtgatatacaagcatata
gcagatcaagcagatgttgatattttggcgaaagagcgcaactataaaaacagagacatt
gtcactattaatgttgatactttcaaaggcgataaaaatgcacttgagaaacagctcgga
atattctacaaagagcatttgcacgaggatgaagagatcagatattgcattgaaggttca
ggctacttcgatgtgcgtaatgggaaggatgacgtatgggtcagatgcaaagttggtcca
ggtgatttacttatcttacccgcaggtatctatcacagattcacactcacagagaccaat
catattaaggcactaagattattcaaggatgaaccaaaatggcaagcttacaatagacct
gatgcagacagcctacccgttcgccatgaatacttacaatctatttaa

DBGET integrated database retrieval system